Conserved Protein Domain Family
galF

?
TIGR01105: galF 
UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit
GalF is a non-catalytic subunit of the UTP-glucose pyrophosphorylase modulating the enzyme activity to increase the formation of UDP-glucose [Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 130175
View PSSM: TIGR01105
Aligned: 4 rows
Threshold Bit Score: 587.384
Threshold Setting Gi: 2501466
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P78083     1 MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASKNAVENHFDTSYELESLLEQR 80  Escherichia coli
CAA50766   1 MTNLKAVIPVAGLGMHMLPATKAIPKEMLPTADKPMIQYIVDEIVAAGIKEILLVTHASKNAVENHFDTSYELESLLEQR 80  Shigella flexneri
P26390     1 MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFDTSYELESLLEQR 80  Salmonella typhimurium
Q48447     3 MANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSKNAVENHFDTSYELEALLEQR 82  Klebsiella pneumoniae
P78083    81 VKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRS 160 Escherichia coli
CAA50766  81 VKRQLLAEVQSICPPGVIIMNVRQGEPLGLGHSILCARPAIGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRS 160 Shigella flexneri
P26390    81 VKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRS 160 Salmonella typhimurium
Q48447    83 VKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFVVVLPDIILDGGTADPLRYNLAAMIARFNETGRS 162 Klebsiella pneumoniae
P78083   161 QVLAKRMPGDLSEYSVIQTKEPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD 240 Escherichia coli
CAA50766 161 QVLAKRMPGDLSEYSVIQTKEPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD 240 Shigella flexneri
P26390   161 QVLAKRMKGDLSEYSVIQTKEPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD 240 Salmonella typhimurium
Q48447   163 QVLAKRMPGDLSEYSVIQTKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD 242 Klebsiella pneumoniae
P78083   241 AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE 297 Escherichia coli
CAA50766 241 AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGSKFRKGIEKLLSE 297 Shigella flexneri
P26390   241 AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE 297 Salmonella typhimurium
Q48447   243 AIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGAKFRESIKKLLA- 298 Klebsiella pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap