Conserved Protein Domain Family

TIGR01102: yscR 
type III secretion apparatus protein, YscR/HrcR family
This model identifies the generic virulence translocation proteins in bacteria. It derives its name:'Yop' from Yersinia enterocolitica species, where this virulence protein was identified. In bacterial pathogenesis, Yop effector proteins are translocated into the eukaryotic cells. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
PSSM-Id: 130172
Aligned: 9 rows
Threshold Bit Score: 271.908
Threshold Setting Gi: 446448158
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P74890       159 LIYLPFLAIDLLISNILLAMGMMMVSPMTISLPFKLLIFLLAGGWDLTLAQL 210 Salmonella enterica subsp. enterica serovar...
Q47856       161 LIYIPFIVIDLIVSNVLLTLGMQMVTPMTLSLPLKMLLLILINGWTRLLDGL 212 Pantoea agglomerans pv. gypsophilae
P37828       160 LLYLVFIVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMDGWSMLIHGL 211 Xanthomonas campestris pv. glycines
Q47856       161 LIYIPFIVIDLIVSNVLLTLGMQMVTPMTLSLPLKMLLLILINGWTRLLDGL 212 Pantoea agglomerans pv. gypsophilae
P37828       160 LLYLVFIVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMDGWSMLIHGL 211 Xanthomonas campestris pv. glycines
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap