Conserved Protein Domain Family
yscR

?
TIGR01102: yscR 
type III secretion apparatus protein, YscR/HrcR family
This model identifies the generic virulence translocation proteins in bacteria. It derives its name:'Yop' from Yersinia enterocolitica species, where this virulence protein was identified. In bacterial pathogenesis, Yop effector proteins are translocated into the eukaryotic cells. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130172
View PSSM: TIGR01102
Aligned: 9 rows
Threshold Bit Score: 271.908
Threshold Setting Gi: 446448158
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P74890        10 LIGILFLLSILPLIIVMGTSFLKLAVVFSILRNALGIQQVPPNIALYGLALVLSLFIMGPTLLAVKERWH--PVQ--VAG 85  Salmonella ente...
P40297        10 LIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALGVQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQanEVS--LTN 87  Yersinia pestis
Q52488         9 LIVMAVAIALLPFAAMVVTSYTKIVVVLGLLRNALGVQQVPPNMVLNGIAMIVSCFVMAPVGMEAMQRAHvqINAqgGTN 88  Ralstonia solan...
AAB17684      38 LLAITAALGLLVLAVVTTTAFVKVSVVLFLVRNALGTQTIPPNIVLYAAALILTMFVSAPIAEQTYDRITdpRLR--YQS 115 Sinorhizobium f...
Q60236         2 LALFLGSLSLIPFLLIVCTAFLKIAMTLLITRNAIGVQQVPPNMALYGIALAATMFVMAPVAHDIQQRVHehPLE--LSN 79  Pseudomonas syr...
Q47856        11 FALFLGALSLIPILMIVCTCFLKISMVLLITRNAIGVQQVPPNMALYGIALAATLFVMAPVFNQMQQQFSqaPAD--MSN 88  Pantoea agglome...
P37828        10 LLVVVIMLGLLPFAAMVVTSYTKIVVVLGLLRNAIGVQQVPPNMVLNGVALLVSCFVMAPVGMEAFKAAAqnYGA--GSD 87  Xanthomonas cam...
AAC38369      14 LIIVFFLLSLLPIFVVIGTSFLKISIVLGILKNALGIQQVPPNMALTSVSLILTMFIMSPIILQINDNISqePIN--YTD 91  Escherichia coli
WP_000526013   7 LIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGIALLLSMFVMWPIMHDAYVYFEdeDVT--FND 84  Salmonella ente...
P74890        86 APFWTsEWDSKALAPYRQFLQKNSEEKEANYFRNLIKRTWP-------EDIKRKIKPDSLLILIPAFTVSQLTQAFRIGL 158 Salmonella ente...
P40297        88 IESVE-KFFDEGLAPYRMFLKQHIQAQEYSFFVDSTKQLWP-------KQYADRLESDSLFILLPAFTVSELTRAFEIGF 159 Yersinia pestis
Q52488        89 ITQVM-PLLDAARDPFREFLNKHTNAREKAFFMRSAQQLWP-------PAKAAQLKDDDLIVLAPAFTLTELTSAFRIGF 160 Ralstonia solan...
AAB17684     116 LDDWA-EAAKAGSQPLLEHLKKFTNEEQRRFFLSSTEKVWP-------EEMRARVTADDFAILVPSFLISELKRAFEIGF 187 Sinorhizobium f...
Q60236        80 ADKLQ-SSLKVVIEPLQRFMTRNTDPDVVAHLLENTQRMWP-------KEMADQANKNDLLLAIPAFVLSELQAGFEIGF 151 Pseudomonas syr...
Q47856        89 MDNLK-TSITNGVAPLQKFMTHNTDPDILIHLQENSVKMWP-------KPMSDDVSKDNLLLVIPAFVLSELQAGFKIGF 160 Pantoea agglome...
P37828        88 NSRVV-VLLDACREPFRQFLLKHTREREKAFFMRSAQQIWP-------KDKAATLKSDDLLVLAPAFTLSELTEAFRIGF 159 Xanthomonas cam...
AAC38369      92 SDFFQ-KVDEKILSPYRGILEKNTEKDNVEFFERAAQKKLG-------NE--TILKKDSLFILLPAFTMGQLEAAFKIGF 161 Escherichia coli
WP_000526013  85 ISSLS-KHVDEGLDGYRDYLIKYSDRELVQFFENAQLKRQYgeeteavKRDKDEIEKPSIFALLPAYALSEIKSAFKIGF 163 Salmonella ente...
P74890       159 LIYLPFLAIDLLISNILLAMGMMMVSPMTISLPFKLLIFLLAGGWDLTLAQL 210 Salmonella enterica subsp. enterica serovar...
P40297       160 LIYLPFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGL 211 Yersinia pestis
Q52488       161 LLYLAFIVIDLVIANLLMALGLSQVTPSNVAIPFKLLLFVVMDGWSVLIHGL 212 Ralstonia solanacearum GMI1000
AAB17684     188 LLYLPFIVIDLIVTTILMAMGMSMVSPTIIAVPFKLFLFVAIDGWSRLMHGL 239 Sinorhizobium fredii
Q60236       152 LIYIPFIVIDLIVSNLLLALGMQMVSPMTLSLPLKLLLFVLVSGWSRLLDSL 203 Pseudomonas syringae pv. syringae
Q47856       161 LIYIPFIVIDLIVSNVLLTLGMQMVTPMTLSLPLKMLLLILINGWTRLLDGL 212 Pantoea agglomerans pv. gypsophilae
P37828       160 LLYLVFIVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMDGWSMLIHGL 211 Xanthomonas campestris pv. glycines
AAC38369     162 LLYLPFIAIDLIISNILLALGMMMVSPVTISIPFKILLFILVGGWQKLFEFL 213 Escherichia coli
WP_000526013 164 YLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGL 215 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap