Conserved Protein Domain Family
V_ATP_synt_F

?
TIGR01101: V_ATP_synt_F 
vacuolar ATP synthase F subunit
This model describes the vacuolar ATP synthase F subunit (14 kDa subunit) in eukaryotes. In some archaeal species this protein subunit is referred as G subunit [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130171
View PSSM: TIGR01101
Aligned: 7 rows
Threshold Bit Score: 185.417
Threshold Setting Gi: 731098
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P39111   1 MAEKRTLIAVIADEDTTTGLLLAGIGQITpETQEKNFFVYQEgKTTKEEITDKFNHFTEeRDDIAILLINQHIAENIRAR 80  Saccharomyces cerevis...
Q24583   5 SAIKGKLISVIGDEDTCVGFLLGGVGEIN-KNRHPNFMVVDK-NTAVSELEDCFKRFLK-RDDIDIILINQNCAELIRHV 81  fruit fly
P31478   5 AAVKGKLISVIGDEDTCVGFLLGGIGEIN-KNRHPNFMVVDK-NTPVSEIEECFKRFVK-RDDIDIILINQNVAELVRHV 81  tobacco hornworm
Q17029   5 SAMKGKLISVIGDEDTCVGFLLGGVGEIN-KNRHPNFMVVDK-NTAVSEIEDCFKRFIK-RDDIDIILINQNYAELIRHV 81  African malaria mosquito
P50408   1 MAGRGKLIAVIGDEDTVTGFLLGGIGELN-KNRHPNFLVVEK-DTTINEIEDTFRQFLN-RDDIGIILINQYIAEMVRHA 77  Norway rat
Q28029   1 magrgkliaVIGDEDTVTGFLLGGIGELN-KNRHPNFLVVEK-DTTINEIEDTFRQFLN-RDDIGIILINQYIAEMVRHA 77  cattle
Q23680   3 SAAKGKILAVIGDEDTVVGFLLGGVGELN-KARKPNYLIVDK-QTTVQEIEEAFNGFCA-RDDIAIILINQHIAEMIRYA 79  Caenorhabditis elegans
P39111  81 VDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE 118 Saccharomyces cerevisiae S288c
Q24583  82 IDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNP 119 fruit fly
P31478  82 IDAHTAPVPSVLEIPSKDHPYDASKDSILRRAKGMFNP 119 tobacco hornworm
Q17029  82 IDSHTAPTPAVLEIPSKDHPYDASKDSILRRAKGMFNP 119 African malaria mosquito
P50408  78 LDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTA 115 Norway rat
Q28029  78 LDAHQRSIPAVLEIPSKEHPYDAAKDSILRRARGMFTA 115 cattle
Q23680  80 VDNHTQSIPAVLEIPSKEAPYDPSKDSILNRARGLFNP 117 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap