Conserved Protein Domain Family

TIGR01101: V_ATP_synt_F 
vacuolar ATP synthase F subunit
This model describes the vacuolar ATP synthase F subunit (14 kDa subunit) in eukaryotes. In some archaeal species this protein subunit is referred as G subunit [Transport and binding proteins, Cations and iron carrying compounds]
PSSM-Id: 130171
Aligned: 7 rows
Threshold Bit Score: 185.417
Threshold Setting Gi: 731098
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P39111  81 VDSFTNAFPAILEIPSKDHPYDPEKDSVLKRVRKLFGE 118 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap