Conserved Protein Domain Family
V_ATP_synt_C

?
TIGR01100: V_ATP_synt_C 
vacuolar ATP synthase 16 kDa proteolipid subunit
This model describes the vacuolar ATP synthase 16 kDa proteolipid subunit in eukaryotes and includes members from diverse groups e.g., fungi, plants, parasites etc. The principal role V-ATPases are the acidification of intracellular compartments of eukaryotic cells. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130170
View PSSM: TIGR01100
Aligned: 17 rows
Threshold Bit Score: 139.059
Threshold Setting Gi: 7530126
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA82977   13 FFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKsYYLFDG 92  upland cotton
CAA65063   13 FFGFLGAAAALVFSCMGAAYGTAKSGVGVACMGVMRPELVMKSIVPVVMAGVLGIYGLIIALIISTGINPKTKsYYLFDG 92  common tobacco
BAA23350   21 FFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST--NVKRDvYKLYDG 98  Acetabularia aceta...
Q00607     11 FFGSIGCAAAIVFTCFGASYGTAKSGVGICATSVTRPDLLVKNVVPVVMAGIIAIYGLVVSVLVSDSLSQKQ---ALYTG 87  Candida tropicalis
P31413     11 FFGAMGCTAAIVFTCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISDALTQDHY--ALYTG 88  Neurospora crassa ...
P50515     12 FFGVMGCTAAIVFASFGAAYGTAKAGVGISAMGVLRPDLIVKNTIPVVMAGIIAIYGLVVSVLISGNLKQIL---SLYSG 88  Schizosaccharomyce...
Q03105     12 FFGVIGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTED---ISLFKS 88  marbled electric ray
Q26250     12 FFGVMGAASAMVFSALGAAYGTAKSGVGISAMSVMRPELIMKCIIPVVMAGIIAIYGLVVAVLIAGKLDEAPT-YTLYQG 90  Norway lobster
P34546     16 FFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVTSASAgYDLNKG 95  Caenorhabditis ele...
XP_644319  30 FFGAMGVTAALVFTVMGAAYGTAKASVGISNMGVMKPDLVIKAFIPVIFAGVIAIYGLIICVILVGGIKPNAN-YTLMKS 108 Dictyostelium disc...
AAA82977   93 YAHLSSGLACGLAGLSAGMAIGIVGDAGV 121 upland cotton
CAA65063   93 YAHLSSGLACGLAGLSAGMAIGIVGDAGV 121 common tobacco
BAA23350   99 YAHLSAGLACGLAGLPAGMAIGIVGDAGV 127 Acetabularia acetabulum
Q00607     88 FIQLGAGLSVGLSGLAAGFAIGIVGDAGV 116 Candida tropicalis
P31413     89 FIQLGAGLAVGLAGLAAGFAIGIVGDAGV 117 Neurospora crassa OR74A
P50515     89 FIQLGAGLSVGLAGLAAGFAIGIVGDAGV 117 Schizosaccharomyces pombe 972h-
Q03105     89 FLQLGAGLSVGLSGLAAGFAIGIVGDAGV 117 marbled electric ray
Q26250     91 FVHMGAGLSVGLSGLAAGFAIGIVGDAGV 119 Norway lobster
P34546     96 FAHLAAGLTCGLCGLGAGYAIGIVGDAGV 124 Caenorhabditis elegans
XP_644319 109 FTDLGAGLTVGLCGLAAGMAIGIVGDSGV 137 Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap