Conserved Protein Domain Family
P5CS

?
TIGR01092: P5CS 
delta l-pyrroline-5-carboxylate synthetase
This protein contains a glutamate 5-kinase (ProB, EC 2.7.2.11) region followed by a gamma-glutamyl phosphate reductase (ProA, EC 1.2.1.41) region. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 130164
View PSSM: TIGR01092
Aligned: 3 rows
Threshold Bit Score: 1253.27
Threshold Setting Gi: 6226882
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O65361   5 RAFVKDVKRVVVKVGTAVVTRSDGR-LALGRLGSLCEQLKELNSDGYEVILVTSGAVSAGRQRLRFRKLVNSSFADLQKP 83  common iceplant
P54888   8 RAFAKDVKRIVVKVGTAVVTGKGGR-LALGRLGAICEQLAELNSDGFEVILVSSGAVGLGRQRLRYRQLVNSSFADLQKP 86  thale cress
P54886  64 RSELKHAKRIVVKLGSAVVTRGDECgLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHS 143 human
O65361  84 Q---------VELDGKACAAVGQNGLMALYDTLFSQLDLTAAQLLVTDNDFRDPSFRTQLTETVYQLLDLKVVPVLNEND 154 common iceplant
P54888  87 Q---------MELDGKACAGVGQSSLMAYYETMFDQLDVTVAQMLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNEND 157 thale cress
P54886 144 GqnqlkemaiPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTND 223 human
O65361 155 AVSTRKAPYEDSSGI----FWDNDSLAALLALELKADLLILLSDVDGLYNGPPSDPRSKLISTYVKEKHQGEITFGDKSR 230 common iceplant
P54888 158 AISTRRAPYKDSTGI----FWDNDSLAALLSLELKADLLILLSDVEGLYTGPPSDSTSKLIHTFIKEKHQDEITFGEKSK 233 thale cress
P54886 224 AVVPPAEPNSDLQGVnvisVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQ-SVTFGTKSR 302 human
O65361 231 LGRGGMTAKVKAAVYAAYAGIPVIIASGKATDN----IIKVIDGQCVGTLFHKDAHLWVQVKETGVRDMAVAARESSRRL 306 common iceplant
P54888 234 LGRGGMTAKVKAAVNAAYGGVPVIITSGYAAEN----ISKVLRGLRVGTLFHQDAHLWAPVVDTTSRDMAVAARESSRKL 309 thale cress
P54886 303 VGMGGMEAKVKAALWALQGGTSVVIANGTHPKVsghvITDIVEGKKVGTFFSEVKPAGPTVEQQGE-----MARSGGRML 377 human
O65361 307 QAVSSEERKKILLDIADALEANEEKILAENEADVAAAQYAGYDRSLVARLAMNPDKISSLAKSIRVLAD-MEEPIGRILK 385 common iceplant
P54888 310 QALSSEDRKQILHDIANALEVNEKTIKAENDLDVAAAQEAGYEESLVARLVMKPGKISSLAASVRQLAE-MEDPIGRVLK 388 thale cress
P54886 378 ATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGR-LAAPLLKRLSLSTSKLNSLAIGLRQIAAsSQDSVGRVLR 456 human
O65361 386 RTEIADGLILEKTSCPLGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEAKRSNAILHKVITSAIPDKVGEKLIGLV 465 common iceplant
P54888 389 KTQVADDLILEKTSSPIGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPETVGGKLIGLV 468 thale cress
P54886 457 RTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLV 536 human
O65361 466 TSRDEIPDLLKLDDVIDLVIPRGSNKLVSQIKESTR-IPVLGHADGICHVYVDKSANMDMAKRIVLDAKTDYPAACNAME 544 common iceplant
P54888 469 TSREEIPDLLKLDDVIDLVIPRGSNKLVSQIKNSTK-IPVLGHADGICHVYVDKSGKLDMAKRIVSDAKLDYPAACNAME 547 thale cress
P54886 537 NTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKgIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALE 616 human
O65361 545 TLLVHKDLAENGGLNDLIVDLRTEGVTMFGGPRidALQEFNIQATQTFNREYSSPACTVEIVDDVYAAIEHINHHGSAHT 624 common iceplant
P54888 548 TLLVHKDLEQNGFLDDLIYVLQTKGVTLYGGPR--ASAKLNIPETKSFHHEYSSKACTVEIVEDVYGAIDHIHQHGSAHT 625 thale cress
P54886 617 TLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKfaSYLTFSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHT 696 human
O65361 625 DCIIAEDHKVAETFLQLVDSAAVLHNASTRFCDGFRFGLGAEVGISTSRIHARGPVGVEGLLTTRWVLKGSGQVVH--GD 702 common iceplant
P54888 626 DCIVTEDSEVAEIFLRQVDSAAVFHNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVEGLLTTRWIMRGKGQVVD--GD 703 thale cress
P54886 697 DVIVTEDENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSdfSE 776 human
O65361 703 KG-VVYTHKDLPLVAQNS 719 common iceplant
P54888 704 NG-IVYTHKDLPVLQRTE 720 thale cress
P54886 777 HGsLKYLHENLPIPQRNT 794 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap