1FUI


Conserved Protein Domain Family
fucI

?
TIGR01089: fucI 
Click on image for an interactive view with Cn3D
L-fucose isomerase
This enzyme catalyzes the first step in fucose metabolism, and has been characterized in Escherichia coli and Bacteroides thetaiotaomicron. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130161
View PSSM: TIGR01089
Aligned: 4 rows
Threshold Bit Score: 1218.64
Threshold Setting Gi: 2624812
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FUI_A         4 ISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLT 83  Escherichia col...
P11552         4 ISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLT 83  Escherichia coli
WP_005692750  22 snriKIGIRPTIDGRRMGVRESLETQTIRMAQSVAQLLQTHIRHTDGTFVECVVADSTIGGVAEAAACADKFKRENVGLT 101 Haemophilus inf...
AAF01484       2 KKYPKIGIRPTIDGRQGGVRESLEEKTMNLAKAVAELISNNLKNGDGSPVECIIADNTIGRVAESAACAEKFEREGVGST 81  Bacteroides the...
1FUI_A        84 ITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFA 163 Escherichia col...
P11552        84 ITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFA 163 Escherichia coli
WP_005692750 102 ITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGAVYLAAALAGHSQLGLPAFSIYGTEVQEADDTNIPEDVKEKLLRFA 181 Haemophilus inf...
AAF01484      82 ITVTSCWCYGAETMDMNPHYPKAVWGFNGTERPGAVYLAAVLAGHAQKGLPAFGIYGRDVQDLDDNTIPEDVAEKILRFA 161 Bacteroides the...
1FUI_A       164 RAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGED 243 Escherichia col...
P11552       164 RAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGED 243 Escherichia coli
WP_005692750 182 RAGLAVASIRGKSYLSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIYDQEEVDLALSWVKQYCKEGVD 261 Haemophilus inf...
AAF01484     162 RAAQAVATMRGKSYLSMGSVSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMEEGIYDHEEYAKAMAWTEKYCKVNEG 241 Bacteroides the...
1FUI_A       244 E---NNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILN 320 Escherichia col...
P11552       244 E---NNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILN 320 Escherichia coli
WP_005692750 262 V---NSLENQRNAEERAELWENVVKMTIITRDLMVGNPKLATLNYAEEALGHNAIAAGFQGQRHWTDHLPNGDFMEAMLN 338 Haemophilus inf...
AAF01484     242 EdfkNRPEKRKKREQKDADWEFVVKMMIIMRDLMTGNPKLKEMGFKEEALGHNAIAAGFQGQRQWTDFYPNGDYPEALLN 321 Bacteroides the...
1FUI_A       321 SSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFADVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDG 400 Escherichia col...
P11552       321 SSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFADVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDG 400 Escherichia coli
WP_005692750 339 STYDWNGVRPPYILATENDSLNAIGMLFGHQLTGKAQIFADVRTYWSQDSVERVTGWRPE---S-GFIHLINSGSAALDG 414 Haemophilus inf...
AAF01484     322 TSFDWNGIREAFVVATENDACNGVAMLFGHLLTNRAQIFSDVRTYWSPEAVKRVTGKELTGLAANGIIHLINSGATTLDG 401 Bacteroides the...
1FUI_A       401 SCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS 480 Escherichia col...
P11552       401 SCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS 480 Escherichia coli
WP_005692750 415 TGEHQDAQGNPTLKPAWDVTEEEAKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGIPFTIHRINLIKGLGPVLQIAEGWS 494 Haemophilus inf...
AAF01484     402 SGQSLDAEGNPVMKEPWNLTDADVENCLKATTWYPADRDYFRGGGFSSNFLSKGGMPVTMMRLNLIKGLGPVLQIAEGWT 481 Bacteroides the...
1FUI_A       481 VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMHNVEETK 560 Escherichia col...
P11552       481 VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMHNVEETK 560 Escherichia coli
WP_005692750 495 IDLPQDVHNKLNQRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATHGHVGADLITLASMLRIPVCMHNVSEKN 574 Haemophilus inf...
AAF01484     482 VEIDPEIHQKLNMRTDPTWPTTWFVPRLCDKSAFKDVYSVMNNWGANHGAISYGHIGQDLITLASMLRIPVCMHNVDENE 561 Bacteroides the...
1FUI_A       561 VYRPSAWAAHGMDIEGQDYRACQNYGPLYK 590 Escherichia coli BW2952
P11552       561 VYRPSAWAAHGMDIEGQDYRACQNYGPLYK 590 Escherichia coli
WP_005692750 575 IFRPSAWNGFGQDKEGQDYRACQNFGPLYK 604 Haemophilus influenzae
AAF01484     562 IFRPTAWNAFGMDKEGADYRACTTYGPIYK 591 Bacteroides thetaiotaomicron
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap