1GQO,1J2Y,3N76


Conserved Protein Domain Family
aroQ

?
TIGR01088: aroQ 
Click on image for an interactive view with Cn3D
3-dehydroquinate dehydratase, type II
This model specifies the type II enzyme. The type I enzyme, often found as part of a multifunctional protein, is described by TIGR01093. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130160
View PSSM: TIGR01088
Aligned: 12 rows
Threshold Bit Score: 227.994
Threshold Setting Gi: 6226839
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GQO_A         2 HFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALH--IQLTFFQSNHEGDLIDAIHEAEEQ-YSGIVLNPGALS 78  Bacillus subtilis
P43878         6 RILLLNGPNLNMLGAREPKHYGSISLESIEEKIQTLATQHN--VKVECFQANSEGKLINKIHESFQQ-VDFILINPAAYT 82  Haemophilus inf...
AAF93471       6 RILVLNGPNLNLLGLREPTHYGSQTLEQIVAILRDQAQKAD--IELEHLQSNREYELIEAIHQAFGK-VDFIIINPAAFT 82  Vibrio cholerae...
P73367         6 KVLVLHGPNLNLLGQREPGIYGSLTLGEIDACLREDGVDLE--AEVSTFQSNSEGQLVTAIHGALGN-YHGIVFNAAAYT 82  Synechocystis s...
Q9RW91         1 MLLILNGPNLNRLGLREPGVYGSQTLEDLERQCEAWGAELE--MSVTCRQSNYEGQLLEWVQDAEEQgFTGLVINPGALT 78  Deinococcus rad...
P36918         5 IVNVINGPNLGRLGRREPAVYGGTTHDELVALIEREAAELG--LKAVVRQSDSEAQLLDWIHQAADA-AEPVILNAGGLT 81  Mycobacterium t...
Q9WYI4         2 KVLVVNGPNLNMLGKRDKNIYGNFSHEDLVKMIEDWGRKNG--VEVEVFQSNHEGKILDRLHRLD---FDGLVINPGAFT 76  Thermotoga mari...
CAB72553       2 KIMIIQGPNVNMLGVREVGIYGAMKMEEIHEQMKLAASQNN--VELDFFQSNFEGEIVDKIQECLGt-VDGIIINAAGYT 78  Campylobacter j...
WP_003230223   3 HFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALH--IQLTFFQSNHEGDLIDAIHEAEEQ-YSGIVLNPGALS 79  Bacillales
Q9ZM37         2 KILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNldVELEFFQTNFEGEIIDKIQESVGSdYEGIIINPGAFS 81  Helicobacter py...
1J2Y_A         2 KILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNldVELEFFQTNFEGEIIDKIQESVGSdYEGIIINPGAFS 81  Helicobacter py...
3N76_A         5 IVNVINGPNLGRLGRREPAVYGGTTHDELVALIEREAAELG--LKAVVRQSDSEAQLLDWIHQAADA-AEPVILNAGGLT 81  Mycobacterium t...
1GQO_A        79 HYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQQ 142 Bacillus subtilis
P43878        83 HTSVALRDALLAVSIPFVEIHLSNVHKREPFRHHSYFSDVAEGVICGLGAKGYEFAFLFAMDYL 146 Haemophilus influenzae Rd KW20
AAF93471      83 HTSVALRDALLGVAIPFIEVHLSNVHAREPFRHHSYLSDKAQGVICGLGAQGYEFALSAAIRAL 146 Vibrio cholerae O1 biovar El To...
P73367        83 HTSIALRDALAAVQLPCVEVHLSNIHKRESFRHISHIAPVAIGQICGFGLNSYRLGLRALVDYL 146 Synechocystis sp. PCC 6803 subs...
Q9RW91        79 HYSYALRDAIAGQRLPVVEVHISNVDAREEFRHQSVTAAVCRGKISGLGFSGYRLAMEYLAEVL 142 Deinococcus radiodurans R1
P36918        82 HTSVALRDACAELSAPLIEVHISNVHAREEFRRHSYLSPIATGVIVGLGIQGYLLALRYLAEHV 145 Mycobacterium tuberculosis
Q9WYI4        77 HYSYAIRDALEIVKVPKVEVHISNIHRREEFRRRSVTAEVCDGQISGLGVYGYLLALEYIKKKL 140 Thermotoga maritima MSB8
CAB72553      79 HTSVAIRDAIAAVALPTIEVHISNVYRREEFRQKSLIAPVCSGTIVGFGPFGYHLALMGIIQIC 142 Campylobacter jejuni subsp. jej...
WP_003230223  80 HYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQQ 143 Bacillales
Q9ZM37        82 HTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNIL 145 Helicobacter pylori J99
1J2Y_A        82 HTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNIL 145 Helicobacter pylori G27
3N76_A        82 HTSVALRDACAELSAPLIEVHISNVHAREEFRRHSYLSPIATGVIVGLGIQGYLLALRYLAEHV 145 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap