Conserved Protein Domain Family
mutY

?
TIGR01084: mutY 
A/G-specific adenine glycosylase
This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130156
View PSSM: TIGR01084
Aligned: 9 rows
Threshold Bit Score: 375.595
Threshold Setting Gi: 499191373
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB84842       9 PFSERLIRWQKQHGRHHLPWQV-K----N------------PYCVWLSEIMLQQTQVATVLD-YYPRFLEKFPTVQTLAA 70  Neisseria menin...
Q05869         5 QFSAQVLDWYDKYGRKTLPWQInK----T------------PYKVWLSEVMLQQTQVTTVIP-YFERFMARFPTVTDLAN 67  Salmonella ente...
P17802         5 QFSAQVLDWYDKYGRKTLPWQIdK----T------------PYKVWLSEVMLQQTQVATVIP-YFERFMARFPTVTDLAN 67  Escherichia col...
P44320        10 pFAKSVLAWYDKFGRKHLPWQQnK----T------------LYGVWLSEVMLQQTQVATVIP-YFERFIKTFPNITALAN 72  Haemophilus inf...
AAF93625       3 pFAQAILTWYDAYGRKNLPWQQnK----N------------AYRVWLSEIMLQQTQVATVIP-YFERFLERFPTVHALAA 65  Vibrio cholerae...
CAB73608       8 KLQENLLLWYEKNGRKTLPWRNlQ----SqncdeslkhidrAYGVYISEIMLQQTQVKSVLErFYFPFLQKFPTLESLAN 83  Campylobacter j...
WP_015482977  15 QFRDDLISWFEREQR-VLPWREdQ----D------------PYKVWVSEVMLQQTRVETVIP-YFLRFVEQFPTVEALAD 76  Bacillus subtilis
WP_020966908  13 fplEALRSWFLESKR-SFPWRDsP----T------------PYRVWVSEVMLQQTRAEVVVP-YFLKWMERFPTLQDLAQ 74  Chlamydia trach...
WP_010888913  19 ALRRDLLGWFDRAGR-DLPWRLgDegrrD------------PYRVWVAEILLQQTQVARGLG-YYERFLEAFPTVQALAA 84  Deinococcus rad...
CAB84842      71 APQDEVLSLWAGLGYYSRARNLHKAAQQVVEQFGGTFPSERKDLETLCGVGRSTAAAICAFSFNRRETILDGNVKRVLCR 150 Neisseria menin...
Q05869        68 APLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIAALPGVGRSTAGAILSLALGKHYPILDGNVKRVLAR 147 Salmonella ente...
P17802        68 APLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLAR 147 Escherichia col...
P44320        73 ASQDEVLHLWTGLGYYARARNLHKAAQKVRDEFNGNFPTNFEQVWALSGVGRSTAGAILSSVLNQPYPILDGNVKRVLAR 152 Haemophilus inf...
AAF93625      66 APQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGVGRSTAAAVLSSVYKKPHAILDGNVKRTLAR 145 Vibrio cholerae...
CAB73608      84 ANEDELLKAWQGLGYYTRARNLKKAALECVDKFGAKLPKDVEDLKKLSGIGAYTAGAIACFGYDQKVSFVDGNIRRVLSR 163 Campylobacter j...
WP_015482977  77 ADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSR 156 Bacillus subtilis
WP_020966908  75 ARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLALLSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSR 154 Chlamydia trach...
WP_010888913  85 APQDAVLKAWEGCGYYARARNLHRAAAIIDEQG---FPQDYAGWLALPGVGPYTAAAVSSLALGEPRAVNDGNVRRVLSR 161 Deinococcus rad...
CAB84842     151 VFARDGNPQDKKFENSLWTLAESLLPseNADMPAYTQGLMDLGATVCKRTKPLCHQCPMADICEAKKQNRTAELPRKKTA 230 Neisseria menin...
Q05869       148 CYAVSGWPGKKEVENTLWTLSEQVTP--ARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPK 225 Salmonella ente...
P17802       148 CYAVSGWPGKKEVENKLWSLSEQVTP--AVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK 225 Escherichia col...
P44320       153 YFAVEGWSGEKKVENRLWALTEQVTP--TTRVADFNQAMMDIGAMVCMRTKPKCDLCPLNIDCLAYKNTNWEKFPAKKPK 230 Haemophilus inf...
AAF93625     146 CFAVEGWPGQKSVENQLWHYAEMHTP--KVDVDKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPK 223 Vibrio cholerae...
CAB73608     164 LFALEN-PSMKELEKR----AKELLN--LNHAFDHNQALLDIGALVCVGKNAKCRICPLYDFCQGKFHT--ELYPRAKKI 234 Campylobacter j...
WP_015482977 157 ILSIWDDIAKPKTRTIFEDAIRAFIS--KEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKK 234 Bacillus subtilis
WP_020966908 155 LFAIEESIDRMNTRREITGLCESLLP--DQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRN-T 230 Chlamydia trach...
WP_010888913 162 LRAEAHPSDK-----WVQEQADRLLD--PARPGAWNEAVMDLGATICVPKSPACDRCPVSAHCAAYQLGQPGDFPA--PK 232 Deinococcus rad...
CAB84842     231 AEVPTLPLYWLIVRNrDGAILLEKRPAKGIWGGLYCVPCFESL--------NGLSDFAAKFS 284 Neisseria meningitidis Z2491
Q05869       226 QTLPERTGYFLLLQH-NQEIFLAQRPPSGLWGGLYCFPQFARE--------DELREWLAQRH 278 Salmonella enterica subsp. enteri...
P17802       226 QTLPERTGYFLLLQH-EDEVLLAQRPPSGLWGGLYCFPQFADE--------ESLRQWLAQRQ 278 Escherichia coli K-12
P44320       231 KAMPEKTTYFLILSK-NGKVCLEQRENSGLWGGLFCFPQFEDK--------SSLLHFLAQEK 283 Haemophilus influenzae Rd KW20
AAF93625     224 TDKPVKATWFVMLYH-DNAVWLEQRPQSGIWGGLYCFPQSE----------------IANIQ 268 Vibrio cholerae O1 biovar El Tor ...
CAB73608     235 LYESLNLNLFLFEFN---KKFAIQKSQDKLYKGMYNFPFFKegeyklskdmgfvgefkhsyt 293 Campylobacter jejuni subsp. jejun...
WP_015482977 235 KKPGIKTMAAIVLTDeDGQVYIHKRPSKGLLANLWEFPNLETQkgiktereQLIAFLENEYG 296 Bacillus subtilis
WP_020966908 231 RAAISRLFRAVVIVLyKDQVLMTKREEKEIMAGLYEFPYYQLpkedccdiekithlvqkdyg 292 Chlamydia trachomatis
WP_010888913 233 ARPQAREVRAVALLIgDAEYAVLEKREGSLLGGLFGLPLEEIGare--taaDALARLQARLG 292 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap