Conserved Protein Domain Family
mpl

?
TIGR01081: mpl 
UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
Alternate name: murein tripeptide ligase [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 130153
View PSSM: TIGR01081
Aligned: 4 rows
Threshold Bit Score: 801.36
Threshold Setting Gi: 488154010
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P37773         2 RIHILGICGTFMGGLAMLARQLGHEVTGSDANVYPPMSTLLEKQGIELIQGYDASQLEP-QPDLVIIGNAMTRGNPCVEA 80  Escherichia col...
AAF95683       2 HIHILGICGTFMGGVAMLARQLGHKVTGSDANVYPPMSTMLEAQGIEIIEGFDPVQLEP-KPDLVVIGNAMSRGNPCVEY 80  Vibrio cholerae...
P43948         3 HIHILGICGTFMGGVAMIAKQMGYHVTGSDTNVYPPMSTFLEEQGIEIIPNYDVAQLQP-APDMVIVGNAMKRGNPCVEY 81  Haemophilus inf...
WP_002225218   3 HIHIIGIGGTFMGGLAAIAKEAGFEVSGCDAKMYPPMSTQLEALGIDVYEGFDAAQLDEfKADVYVIGNVAKRGMDVVEA 82  Neisseria menin...
P37773        81 VLEKNIPYMSGPQWLHDFVLRDRWVLAVAGTHGKTTTAGMATWILEQCGYKPGFVIGGVPGNFEVSAHLGE--------- 151 Escherichia col...
AAF95683      81 VLNHNLRYTSGPQWLQDFLLHDRWVIAVSGTHGKTTTSSMIAWVLEHCGYQPGFLVGGVLGNFGISARLGE--------- 151 Vibrio cholerae...
P43948        82 VLENNLKYTSGPQWLHDHLLRDRWVLAVSGTHGKTTTTGMLTWVLEQNGLKSGFLIGGIAGNFGISARLGD--------- 152 Haemophilus inf...
WP_002225218  83 ILNLGLPYISGPQWLSENVLHHHWVLGVAGTHGKTTTASMLAWVLEYAGLAPGFLIGGVPENFGVSARLPQtprqdpnsq 162 Neisseria menin...
P37773       152 SDFFVIEADEYDCAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRIIWPENDINLKQTMA 231 Escherichia col...
AAF95683     152 SMFFVVEADEYDSAFFDKRSKFVHYHPRTLVMNNLEFDHADIFDNLEAIKRQFHHLVRTVPGNGRILAPKQDEALADVLQ 231 Vibrio cholerae...
P43948       153 SPYFIIEADEYDTAFFDKRSKFVHYNPRTLIVNNISFDHADIFDDLKAIQRQFHHMIRTIPASGLVLSSASEQSAKETLA 232 Haemophilus inf...
WP_002225218 163 SPFFVIEADEYDTAFFDKRSKFVHYRPRTAVLNNLEFDHADIFADLGAIQTQFHYLVRTVPSEGLIVCNGRQQSLQDTLD 242 Neisseria menin...
P37773       232 MGCWSEQELVGEQGHWQAKKLTTDASEWEVLLDGEKVGEVKWSLVGEHNMHNGLMAIAAARHVGVAPADAANALGSFINA 311 Escherichia col...
AAF95683     232 RGCWSETEFSGEQGEWQAEKITADGSQFHVLLKGERVGQVNWSLVGDHNVSNALMAIAAARHVGVAPELACEALGLFVNT 311 Vibrio cholerae...
P43948       233 LGCWSQQQFLGKDNEWFAERITNDASHFAVFHHGEKVAEVKWNVVGQHNMHNALMAIAAAHHTGVAIEDACKALGSFVNA 312 Haemophilus inf...
WP_002225218 243 KGCWTPVEKFGTEHGWQAGEANADGS-FDVLLDGKTAGRVKWDLMGRHNRMNALAVIAAARHVGVDIQTACEALGAFKNV 321 Neisseria menin...
P37773       312 RRRLELRGEANGVTVYDDFAHHPTAILATLAALRGKVGgTARIIAVLEPRSNTMKMGICKDDLAPSLGRADEVFLLQPAH 391 Escherichia col...
AAF95683     312 KRRLELKGEINGVTVYDDFAHHPTAIELTLGGLRNKVG-DKKIIAVLEPRSATMKLGVHKETLAASLHSADSVYLYQPSN 390 Vibrio cholerae...
P43948       313 KRRLEVKGEVNSITVYDDFAHHPEAILATLTALRDKVGgGVRILAVLEPRSNTMKMGVHKDDIAPALGRADAVFMLQPEQ 392 Haemophilus inf...
WP_002225218 322 KRRMEIKGTANGITVYDDFAHHPTAIETTIQGLRQRVG-GARILAVLEPRSNTMKLGTMKSALPVSLKEADQVFCYAGG- 399 Neisseria menin...
P37773       392 IPWQVAEVAEACVQPAHWSGDVDTLADMVVKTAQPGDHILVMSNGGFGGIHQKLLDGLA 450 Escherichia coli K-12
AAF95683     391 IPWSVEEVAKQCQQPAQVSANMDEFVAMIAKEAQAGDQILVMSNGGFEGIHGKLLAALQ 449 Vibrio cholerae O1 biovar El Tor str...
P43948       393 LSWEVADIANQCVQPAYWNANLDRLVDMIVAKAQPTDHILVMSNGSFGGIHQKILDKLK 451 Haemophilus influenzae Rd KW20
WP_002225218 400 VDWDVAEALAPLGGRLNVGKDFDAFVAEIVKNAEVGDHILVMSNGGFGGIHGKLLEALR 458 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap