4BOF,1LXY


Conserved Protein Domain Family
arcA

?
TIGR01078: arcA 
Click on image for an interactive view with Cn3D
arginine deiminase
Arginine deiminase is the first enzyme of the arginine deiminase pathway of arginine degradation. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 273430
View PSSM: TIGR01078
Aligned: 8 rows
Threshold Bit Score: 578.197
Threshold Setting Gi: 489500264
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4BOF_A         9 VYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIPFLEDAQKEHDAFAQALRDEGIEVLYLETLAAESLVTP--EIRE 86  Streptococcus p...
AAF93596       6 VGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLAVEAAGVEHDAFANTLRTQDVEVLLLHDLLEETLAIP--EARQ 83  Vibrio cholerae...
O53088         7 VNSEIGKLKTVLLKRPGKEVENITPDIMYRLLFDDIPYLPTIQKEHDQFAQTLRDNGVEVLYLENLAAEAIDAG--DVKE 84  Lactobacillus s...
P23793        13 VYSEIGELESVLVHEPGREIDYITPARLDELLFSAILESHDARKEHKQFVAELKANDINVVELIDLVAETYDLAsqEAKD 92  Mycoplasma argi...
WP_003111744  10 VHSEAGKLRKVMVCSPGLAHQRLTPSNCDELLFDDVIWVNQAKRDHFDFVTKMRERGIDVLEMHNLLTETIQNP--EALK 87  Pseudomonas
WP_002557431  11 IFSEIGRLKKVLLHRPGEELENLTPLIMKNFLFDDIPYLKVARQEHEVFVNILKDNSVEIEYVEDLVSEVLASSv-ALKN 89  Lyme disease sp...
1LXY_A        12 VYSEIGELESVLVHEPGREIDYITPARLDELLFSAILESHDARKEHKQFVAELKANDINVVELIDLVAETYDLAsqEAKD 91  Mycoplasma argi...
WP_003405169   7 sNSEVGALRVVILHRPGAELRRLTPRNTDQLLFDGLPWVSRAQDEHDEFAELLASRGAEVLLLSDLLTEALHHSg-AARM 85  Mycobacterium t...
4BOF_A        87 AFIDEYLSEANi-RGRATKKAIRELLMAIEDnQELIEKTMAGVQKSelpeipasekgltDLve-snYPFAIDPMPNLYFT 164 Streptococcus p...
AAF93596      84 WLLNTQISDFR--FGPTFARELRHALNHLDD-HHLTTLLLGGLAFSelhlesdsmlpkmRQp----LDFVIEPLPNHLFT 156 Vibrio cholerae...
O53088        85 AFLDKMLNESHi-KSPQVQAALKDYLISMAT-LDMVEKIMAGVRTNeidik---skaliDVsadddYPFYMDPMPNLYFT 159 Lactobacillus s...
P23793        93 KLIEEFLEDSEpvLSEEHKVVVRNFLKAKKTsRELVEIMMAGITKY-------------DLgieadHELIVDPMPNLYFT 159 Mycoplasma argi...
WP_003111744  88 WILDRKITADS--VGLGLTSELRSWLESLEP-RKLAEYLIGGVAADdlpaseganilkmYReylghSSFLLPPLPNTQFT 164 Pseudomonas
WP_002557431  90 KFISQFILEAEi-KTDGVINILKDYFSNLTV-DNMVSKMISGVAREelkdc---efsldDWvn-gsSLFVIDPMPNVLFT 163 Lyme disease sp...
1LXY_A        92 KLIEEFLEDSEpvLSEEHKVVVRNFLKAKKTsRELVEIMMAGITKY-------------DLgieadHELIVDPMPNLYFT 158 Mycoplasma argi...
WP_003405169  86 QGIAAAVDAPR--LGLPLAQELSAYLRSLDP-GRLAHVLTAGMTFNelpsdtrtdvslvLRmh-hgGDFVIEPLPNLVFT 161 Mycobacterium t...
4BOF_A       165 RDPFATIGTGVSLNHMFSETRNRETLYGKYIFTHHPIYGGGkvPMVY-D----RNETTRIEGGDELVLSKDVLAVGISQR 239 Streptococcus p...
AAF93596     157 RDTSCWVYGGVSLNPMMKPARQRETNHLRAIYRWHPIFAQHpfIHYF-GiddlHYDNANIEGGDVLVIGKGAVLIGMSER 235 Vibrio cholerae...
O53088       160 RDPAASMGDGLTINKMTFEARQRESMFMEVIMQHHPRFANQgaQVWR-D----RDHIDRMEGGDELILSDKVLAIGISQR 234 Lactobacillus s...
P23793       160 RDPFASVGNGVTIHYMRYKVRQRETLFSRFVFSNHPKLINT--PWYY-D----PSLKLSIEGGDVFIYNNDTLVVGVSER 232 Mycoplasma argi...
WP_003111744 165 RDTTCWIYGGVTLNPMYWPARRQETLLTTAIYKFHPEFANAefEIWY-GdpdkDHGSSTLEGGDVMPIGNGVVLIGMGER 243 Pseudomonas
WP_002557431 164 RDPFASIGNGITINKMYTKVRRRETIFAEYIFKYHSAYKENv-PIWF-N----RWEETSLEGGDEFVLNKDLLVIGISER 237 Lyme disease sp...
1LXY_A       159 RDPFASVGNGVTIHYMRYKVRQRETLFSRFVFSNHPKLINT--PWYY-D----PSLKLSIEGGDVFIYNNDTLVVGVSER 231 Mycoplasma argi...
WP_003405169 162 RDSSIWIGPRVVIPSLALRARVREASLTDLIYAHHPRFTG----VRRaY----ESRTAPVEGGDVLLLAPGVVAVGVGER 233 Mycobacterium t...
4BOF_A       240 TDAASIEKLLVNIFKQn-LGFKKVLAFEFANNRKFMHLDTVFTMVDYDKFTIHPEIEGDL---RVYSVTYD-NEELHIV- 313 Streptococcus p...
AAF93596     236 TSPQGVENLAAALFKH--GQASKVIAINLPKHRSCMHLDTVMTHMDVDTFSVYPEVMRKDl-pTWRLTPKG-NNGDMRV- 310 Vibrio cholerae...
O53088       235 TSAQSIEELAKVLFANh-SGFEKILAIKIPHKHAMMHLDTVFTMIDYDKFTIHPGIQGAGgmvDTYILEPG-NNDEIKI- 311 Lactobacillus s...
P23793       233 TDLQTVTLLAKNIVANkeCEFKRIVAINVPKWTNLMHLDTWLTMLDKDKFLYSPIANDVFk-fWDYDLVNG-GAEPQPV- 309 Mycoplasma argi...
WP_003111744 244 SSRQAIGQVAQSLFAk--GAAERVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVKEIvpfSLRPDPSS-PYGMNIR- 319 Pseudomonas
WP_002557431 238 TEAGSVEKLAASLFKNk-APFSTILAFKIPKNRAYMHLDTVFTQIDYSVFTSFTSDDMYf---SIYVLTYNsNSNKINIk 313 Lyme disease sp...
1LXY_A       232 TDLQTVTLLAKNIVANkeCEFKRIVAINVPKWTNLMHLDTWLTMLDKDKFLYSPIANDVFk-fWDYDLVNG-GAEPQPV- 308 Mycoplasma argi...
WP_003405169 234 TTPAGAEALARSLFDD--DLAHTVLAVPIAQQRAQMHLDTVCTMVDTDTMVMYANVVDTLeafTIQRTPDG-----VTI- 305 Mycobacterium t...
4BOF_A       314 EEKGDLAELLAANLGvEKVDLIRCGg--DNLVAAGREQWNDGSNTLTIAPGVVVVYNRNTITNAILESKGLKLIKIHGSE 391 Streptococcus p...
AAF93596     311 EQVPSYLHAIEQALGvDYLKIITTG---GNSYEAEREQWNDANNVLTVKPGVVIGYERNVYTNEKYDKAGIKVLTIPGNE 387 Vibrio cholerae...
O53088       312 THQTDLEKVLRDALEvPELTLIPCGg--GDAVVAPREQWNDGSNTLAIAPGVVVTYDRNYVSNENLRQYGIKVIEVPSSE 389 Lactobacillus s...
P23793       310 ENGLPLEGLLQSIIN-KKPVLIPIAgegASQMEIERETHFDGTNYLAIRPGVVIGYSRNEKTNAALEAAGIKVLPFHGNQ 388 Mycoplasma argi...
WP_003111744 320 REEKTFLEVVAESLGlKKLRVVETGg---NSFAAEREQWDDGNNVVCLEPGVVVGYDRNTYTNTLLRKAGVEVITISASE 396 Pseudomonas
WP_002557431 314 KEKAKLKDVLSFYLG-RKIDIIKCAg--GDLIHGAREQWNDGANVLAIAPGEVIAYSRNHVTNKLFEENGIKVHRIPSSE 390 Lyme disease sp...
1LXY_A       309 ENGLPLEGLLQSIIN-KKPVLIPIAgegASQMEIERETHFDGTNYLAIRPGVVIGYSRNEKTNAALEAAGIKVLPFHGNQ 387 Mycoplasma argi...
WP_003405169 306 GDAAPFAEAAAKAMGiDKLRVIHTG---MDPVVAEREQWDDGNNTLALAPGVVVAYERNVQTNARLQDAGIEVLTIAGSE 382 Mycobacterium t...
4BOF_A       392 LVRGRGGPRCMSMPFEREDI 411 Streptococcus pyogenes
AAF93596     388 LGRGRGGARCMSCPIERDGI 407 Vibrio cholerae O1 biovar El Tor str. N16961
O53088       390 LSRGRGGPRCMSMPLVRRKT 409 Lactobacillus sakei
P23793       389 LSLGMGNARCMSMPLSRKDV 408 Mycoplasma arginini
WP_003111744 397 LGRGRGGGHCMTCPIVRDPI 416 Pseudomonas
WP_002557431 391 LSRGRGGPRCMSMSLVREDI 410 Lyme disease spirochete
1LXY_A       388 LSLGMGNARCMSMPLSRKDV 407 Mycoplasma arginini
WP_003405169 383 LGTGRGGPRCMSCPAARDPL 402 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap