1J3A,3IZS,4W20


Conserved Protein Domain Family
L13_A_E

?
TIGR01077: L13_A_E 
Click on image for an interactive view with Cn3D
ribosomal protein uL13, archaeal/eukaryotic form
This model represents ribosomal protein of L13 from the Archaea and from the eukaryotic cytosol. Bacterial and organellar forms are represented by model TIGR01066. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 162192
View PSSM: TIGR01077
Aligned: 9 rows
Threshold Bit Score: 184.173
Threshold Setting Gi: 6685871
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1J3A_A     2 RIINADGLILGRLASRVAKMLLEGEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTLTNPRR-GPFYPKRSDEIVRRTIR 80  Pyrococcus horikosh...
P54023     2 TVIDAEGAILGRLASEVAKRVLRGEEIVIVNAEMVVITGNKDWIIKTYQEEREKKNVANPRRfGPKFPRRPDDILRRTIR 81  Methanocaldococcus ...
O59300     2 RIINADGLILGRLASRVAKMLLEGEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTLTNPRR-GPFYPKRSDEIVRRTIR 80  Pyrococcus horikosh...
O29137    17 TVIDASGHILGRLSSKIAKRLLNGERIVVVNAEKAVITGDKYMVFERYKEKYDRGSKEK----GPYFPRHPERIFKRTVR 92  Archaeoglobus fulgi...
Q9YB50    11 IVVDGSGMIMGRLASVVAKLLLAGWRVNVVNAEKIVLSGDPRMVVESYRTTVLGVKSHFSHKwRPKRPRTPQRLFKHAVR 90  Aeropyrum pernix K1
P35427     7 LVLDGRSHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSR-GPYHFRAPSRIFWRTVR 85  Norway rat
CAA86145   7 VVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRKATAFNKTR-GPFHFRAPSRIFYKALR 85  baker's yeast
3IZS_K     7 VVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRKATAFNKTR-GPFHFRAPSRIFYKALR 85  Saccharomyces cerev...
4W20_O     8 LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSR-GPYHFRAPSRIFWRTVR 86  pig
1J3A_A    81 GMLPWKTDRGRKAFRRLKVYVGIPKEFqdkqleTIVEAH-VSRLSRP-KYVTVGEVAKFLGGKF 142 Pyrococcus horikoshii OT3
P54023    82 KMLPYKKPKGREAFKRVKVYVGNPKNL------TVDEKI-SHKLNTT-KYITLAELSKHLGAKF 137 Methanocaldococcus jannaschii DSM 2661
O59300    81 GMLPWKTDRGRKAFRRLKVYVGIPKEFqdkqleTIVEAH-VSRLSRP-KYVTVGEVAKFLGGKF 142 Pyrococcus horikoshii OT3
O29137    93 GMLPWKSSRGRDAYRRLRVFMGVPEELqgrefeKIEDAL-LEKVSKTdKYVTLAEVSRYLGFRG 155 Archaeoglobus fulgidus DSM 4304
Q9YB50    91 GMLPKNKARGRRALARLRVYVGVPDELkgrefvRFPEAD-ASRLSSH--YIELGAVARQLGWKG 151 Aeropyrum pernix K1
P35427    86 GMLPHKTKRGQAALERLKVLDGIPPPYdkkkrmVVPAALkVVRLKPTrKFAYLGRLAHEVGWKY 149 Norway rat
CAA86145  86 GMVSHKTARGKAALERLKVFEGIPPPYdkkkrvVVPQALrVLRLKPGrKYTTLGKLSTSVGWKY 149 baker's yeast
3IZS_K    86 GMVSHKTARGKAALERLKVFEGIPPPYdkkkrvVVPQALrVLRLKPGrKYTTLGKLSTSVGWKY 149 Saccharomyces cerevisiae S288c
4W20_O    87 GMLPHKTKRGQAALDRLKVFDGIPPPYdkkkrmVVPAALkVVRLKPTrKFAYLGRLAHEVGWKY 150 pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap