Conserved Protein Domain Family
uvrD

?
TIGR01075: uvrD 
DNA helicase II
Designed to identify uvrD members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130147
View PSSM: TIGR01075
Aligned: 6 rows
Threshold Bit Score: 1195
Threshold Setting Gi: 499289472
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF82863       6 VLDHLNQNQREAVAAAPGHYLILAGAGSGKTRVLTHRIVWLNEVHGVPTHSMMAVTFTNKAAGEIQQRIDLQLRHGKR-- 83  Xylella fastidi...
AAC46278       6 LLDSLNEKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLLSVENCSPYSIMAVTFTNKAAAEMRHRIEHLIGTSQG-- 83  Serratia marces...
P03018         6 LLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQG-- 83  Escherichia col...
AAF93366       7 LLDGLNDKQREAVAAPLENLLILAGAGSGKTRVLVHRIAWLMSVEEASPFSVMAVTFTNKAAAEMRGRIEELMHGTAS-- 84  Vibrio cholerae...
Q02322         7 LLDGLNDKQRERVAAPLGNHLVLAGAGSGKTRVLTHRIAWLIAVENISEGSIMAVTFTNKAAAEMRHRIQSTLAKHAQhq 86  Haemophilus inf...
WP_010980762  10 LLQGLNPEQLSAVTWPPQSALVLAGAGSGKTRVLTTRIAWLLQSGQASVHSIMAVTFTNKAAKEMQTRLGAMIPINVR-- 87  Neisseria menin...
AAF82863      84 --GMWIGTFHSLAHRLLRLHWNDATLPENFQVIDSDDQLRLVKRVIQSLGLNDTLFPPKQAMWWINTQKDEGRRPEHIQP 161 Xylella fastidi...
AAC46278      84 --GMWIGTFHGLAHRLLRAHHLEANLPQDFQILDSDDQLRLLKRIIKALNVDEKQWPPRQAMWYINGKKDEGLRPQHVET 161 Serratia marces...
P03018        84 --GMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQS 161 Escherichia col...
AAF93366      85 --GMWCGTFHGICHRILRAHYLDAKLLEDFQIIDSDDQQRLLKRLIKAHNLDDKQWPARQVAWWINNQKDEGLRPTHINA 162 Vibrio cholerae...
Q02322        87 lfGMWIGTFHSIAHRLLRAHHLDVGLPQDFQILDSEDQLRLIKRLLKLHNFDEKAFPPKQACWYINNKKDEGLRPNDIED 166 Haemophilus inf...
WP_010980762  88 --AMWLGTFHGLCHRFLRLHHRDAGLPSSFQILDGGDQLSLIKRLLKSLNIAEEIIAPRSLQGFINAQKESGLRASVLSA 165 Neisseria menin...
AAF82863     162 ESHdDWIETQRRIYAEYQERCNRAGLVDFAELLLRAHELLRDTPALLTHYRSRFREILIDEFQDTNAIQYAFVRILANET 241 Xylella fastidi...
AAC46278     162 YNN-PVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNVLVDEFQDTNSIQYAWIRLLAGGN 240 Serratia marces...
P03018       162 YGN-PVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT 240 Escherichia col...
AAF93366     163 FD--PVTQTYLKLYTAYQEACDRAGLVDFAEILLRALELLRGNQHIREHYQARFKHILVDEFQDTNAIQYAWLRMMAGAQ 240 Vibrio cholerae...
Q02322       167 FND-RQEREWIKIYQIYQDTCDRAGLVDFAELLIRVYELFEKKPLILQRYQQRFQHILVDEFQDTNKIQYKWIKILAGKT 245 Haemophilus inf...
WP_010980762 166 PD--PHTRRMIECYAEYDKICQREGVVDFAELMLRSYEMLQNNEILRQHYQNRFNHILVDEFQDTNKLQYAWLKLIAGNH 243 Neisseria menin...
AAF82863     242 GHVIAVGDDDQAIYGWRGAKVEHVQHFLKDFPNVQTIRLEQNYRSSANILDAANAIIAHNPDRIGKRLWTESGVGESIDL 321 Xylella fastidi...
AAC46278     241 SNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQNYRSTSNILKAANTLIANNDGRMGKNLWTEGGEGEPISL 320 Serratia marces...
P03018       241 GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENNNGRLGKKLWTDGADGEPISL 320 Escherichia col...
AAF93366     241 SNVMIVGDDDQSIYGWRGARVENIEKFTREFPSVNTIRLEQNYRSTKTILEASNTLIANNSERMGKQLWTDGLVGEPISV 320 Vibrio cholerae...
Q02322       246 GQVMIVGDDDQSIYGWRGAQIENIQKFLKDFK-AETIRLEQNYRSTANILNSANELIANNSDRLGKNLWTEGEKGDPVGI 324 Haemophilus inf...
WP_010980762 244 AAVFAVGDDDQSIYRFRGASVGNMTALMEEFHIDAPVKLEQNYRSVGNILAAANAVIENNDERLGKNLRTDAEAGDKIRY 323 Neisseria menin...
AAF82863     322 YAAYNEIDEARYIVERACQWVRDGGSYGEIAVLYRSNAQSRAFEEVLQSEHIPYRVYGGMRFFERAEIKDALAYLRLLAN 401 Xylella fastidi...
AAC46278     321 YCAFNELDEARFVVNRIKTWQDNGGALNDCAILYRSNAQSRVLEEALLQTAMPYRIYGGQRFFERQEIKDALAYLRLISN 400 Serratia marces...
P03018       321 YCAFNELDEARFVVNRIKTWQDNGGALAECAILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIAN 400 Escherichia col...
AAF93366     321 YSAYNELDEARFVVSKIKGWQEQGGTLTDCAILYRNNAQSRVLEEALLQASLAYRIYGGMRFFERQEIKDALSYLRLINN 400 Vibrio cholerae...
Q02322       325 YSAFNELDEAKFVASQIQDWVEHGGKLDDCAVLYRSNSQSRVIEEALIRCQIPYRIYGGMRFFERQEIKDALAYLRLINN 404 Haemophilus inf...
WP_010980762 324 YSAFTDLEEARFILDETKALEREGWDLDEIAVLYRSNAQSRVIEQSLFRSGIPYKIYGGLRFYERQEIKHALAYLRLAVN 403 Neisseria menin...
AAF82863     402 RSDDAAFERVVNTPVRGIGERTLDEVRHLARTQGLALWDAAMACTQSTTLTARARNALASFLNLLQQLAVETSQMGLAER 481 Xylella fastidi...
AAC46278     401 RNDDAAFERVVNTPTRGIGDRTLDVVRQAARDRQLTLWQATRELMQDKVLAGRAASALQRFIELVESLAHETADMPLHVQ 480 Serratia marces...
P03018       401 RNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASALQRFMELIDALAQETADMPLHVQ 480 Escherichia col...
AAF93366     401 RNDDTAFERVINTPPRGLGDKTLETIRFAARDRGCTLWDASVGLLNDQVLTGRAASALSRFVELINALEEEGIDMPLHVL 480 Vibrio cholerae...
Q02322       405 RQDDAAFERVINTPTRGIGDRTLDILRNLTRERQITLWQAVQVATQENMLAGRASTALLRFQELINSLQLDTAEMPLFAQ 484 Haemophilus inf...
WP_010980762 404 PDDDNALLRVINFPPRGIGARTVENLQTASNEQGITLWQAACN-------AGAKAAKVVAFVRLIEALRNQVGQLSLSEI 476 Neisseria menin...
AAF82863     482 IDHMLLRSELREHWKKEArgSLDAESRQENLDELVSVASRFV--------LPQNDEDtpiMTELDAFLSYTCLESGDGQV 553 Xylella fastidi...
AAC46278     481 TDRVIRDSGLFIMYEQEK--GEKGQARIENLEELVTATRQFS--------YQDEYQD---LMPLQAFLSHAALEAGEGHA 547 Serratia marces...
P03018       481 TDRVIKDSGLRTMYEQEK--GEKGQTRIENLEELVTATRQFS--------YNEEDED---LMPLQAFLSHAALEAGEGQA 547 Escherichia col...
AAF93366     481 TDHAVKTSGLLEMYQQEK--GEKSKARIENLEELVTATRQFE--------KPEEAQE---MTMLTAFLTHAALEAGEGQA 547 Vibrio cholerae...
Q02322       485 TDFVIKHSGLYEMYQQEK--GEKGEVRIENLEELVTATREFI--------KPDNAEE---MTELTAFLTHASLEAGEEQA 551 Haemophilus inf...
WP_010980762 477 IVGILKDSGLTEHYRTQK---GDNQDRLDNLDELVNAAIEFKpedsnfeiLPENISDd-pAFPILAFLSNAALESGENQA 552 Neisseria menin...
AAF82863     554 QAGEEGVQLMTLHSAKGLEFPLVFLVGLENGLFPSARSLDEHGRLEEERRLAYVGITRARHKLILSYAEARRIHGKDNYN 633 Xylella fastidi...
AAC46278     548 DAYQDAVQLMTLHSAKGLEFPLVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYH 627 Serratia marces...
P03018       548 DTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYH 627 Escherichia col...
AAF93366     548 DEHDDAVQLMTLHSAKGLEFPLVFMVGVEEGMFPSQMSAEEAGRLEEERRLCYVGMTRAMQKLYITYAEMRRLYGQDKYH 627 Vibrio cholerae...
Q02322       552 SPHQSCVEMMTLHSAKGLEFPRVFMVGVEEGLFPSFRSFEEPGRLEEERRLAYVGITRAKKKLTISYAESRRLYAKEERH 631 Haemophilus inf...
WP_010980762 553 GAGEKAVQLMTVHAAKGLEFNAVFLTGMEEGRFPSEMSLAERGGLEEERRLMYVAITRARKRLYITMAQQRMLHGQTQFG 632 Neisseria menin...
AAF82863     634 IPSRFLREIPRDLLHEVRPTIQVSRQTPLGAVQRPAHDe-rDA-------APIKLGVNVMHPTFGCGVVVDYEGSGAHTR 705 Xylella fastidi...
AAC46278     628 RPSRFIGELPEECVEEVRLRASVSRPVNHRRMGTPISE---ND-------TGYKLGQRVRHPKFGEGTIVNLEGSGEHSR 697 Serratia marces...
P03018       628 RPSRFIGELPEECVEEVRLRATVSRPVSHQRMGTPMVE---ND-------SGYKLGQRVRHAKFGEGTIVNMEGSGEHSR 697 Escherichia col...
AAF93366     628 KPSRFIRELPEGCLDEVRMKAQVSRPTSTGRFSQTVVKesfNE-------TGFNLGSRVRHPKFGEGTIINFEGSGPQSR 700 Vibrio cholerae...
Q02322       632 LPSRFIAELPRECIQEIRLRGTVTRAMNLAKVGSLSNTs-aVE-------NEWKMGQKVKHEKFGFGTVINVEGSENNTR 703 Haemophilus inf...
WP_010980762 633 IVSRFVEEIPPEVLHYLSVKKPAYDSYGNTRQTAASKDkiiDDykqpqtyAGFRIGQNVRHAKFGTGVIIDAADKGESAR 712 Neisseria menin...
AAF82863     706 VQIKFDDVGTKWLVMAYAKLS 726 Xylella fastidiosa 9a5c
AAC46278     698 LQIAFPGEGIKWLVAAYARLE 718 Serratia marcescens
P03018       698 LQVAFQGQGIKWLVAAYARLE 718 Escherichia coli K-12
AAF93366     701 VQVAFNGEGIKWLVTAYARLE 721 Vibrio cholerae O1 biovar El Tor str. N16961
Q02322       704 LQIAFQAQGIKWLIAHLAKLE 724 Haemophilus influenzae Rd KW20
WP_010980762 713 LTINFGKQGVKELDTKFAKLE 733 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap