1UAA


Conserved Protein Domain Family
rep

?
TIGR01074: rep 
Click on image for an interactive view with Cn3D
ATP-dependent DNA helicase Rep
Designed to identify rep members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130146
View PSSM: TIGR01074
Aligned: 9 rows
Threshold Bit Score: 1105.96
Threshold Setting Gi: 9107919
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UAA_A         2 RLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMI 81  Escherichia col...
P09980         2 RLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMI 81  Escherichia col...
AAF33474       2 RLNPGQQHAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMI 81  Salmonella ente...
P44804         2 KLNPQQQQAVEYVTGPCLVLAGAGSGKTRVIINKIAHLIEKCGYSPKQIAAVTFTNKAAREMKERVAHSIGKEQSKGLLV 81  Haemophilus inf...
AAF85477      25 GLNSPQRAAVLYREGPLLVLAGAGSGKTHVIVEKIAYLITSDCYPAKRIAAITFTNKSAKEMRERVAKQIKSSRADGLTI 104 Xylella fastidi...
AAG08681       3 RLNPRQQEAVNYVGGPLLVLAGAGSGKTSVITRKIAYLVQQCGIRAQYIVAVTFTNKAAREMKERVGTLLRGGEGKGLTV 82  Pseudomonas aer...
O51889         2 SLNFNQKNAIELINGPCLILAGAGSGKTKVIINKIIYLINNCQYKPGNIIAVTFTNKAAHEIKVRLAKHLNLLQIKKMII 81  Buchnera aphidi...
WP_002225110   3 KLNPQQLEAVRYLGGPLLVLAGAGSGKTGVITQKIKHLIVNVGYLPHTVAAITFTNKAAAEMQERVAKMLPKPQTRGLTI 82  Neisseria menin...
AAF93343       2 KLNPRQDEAVKYVSGPCLVLAGAGSGKTRVITNKIAYLVQQCGYKARNIAAVTFTNKAAREMKERVAQTLGKGESRGLMV 81  Vibrio cholerae...
1UAA_A        82 STFHTLGLDIIKREYAALGMKANFSLFDDTDQLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERD 161 Escherichia col...
P09980        82 STFHTLGLDIIKREYAALGMKANFSLFDDTDQLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERD 161 Escherichia col...
AAF33474      82 STFHTLGLDIIKREYAALGMKSNFSLFDDTDQVALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPAQAAAGAKGERD 161 Salmonella ente...
P44804        82 STFHTLGFDILKREYKALGFKSNMTLFDEHDQFALLKELTADVLKEDKDLLRELISVISNWKNDLISPKQAFALARDAKY 161 Haemophilus inf...
AAF85477     105 CTFHALGLKFLQIEHDAVGLKPGFSVFDADDADAQINDLLHG---AKQDVIDDTKRRISRAKNAGLSPEQALAAARTTRE 181 Xylella fastidi...
AAG08681      83 STFHNLGLNIIRKEHERLGYKPGFSIFDESDIKALLTDIMQKEY-SGDDGVDEIKNYIGAWKNDLILPEEALEKARNPKE 161 Pseudomonas aer...
O51889        82 STFHSLGLEIIKKEINTLKFNSNFSLFDERDQMMLLKKICSKSIKNDTKLLKKLVFMISFWKNKFLTPLQVQLSAQSNLE 161 Buchnera aphidi...
WP_002225110  83 CTFHSLGMKILREEANHIGYKKNFSILDSTDSAKIIGELLGG---TGKEAVFKAQHQISLWKNDLKTPEDVVQTASNIWE 159 Neisseria menin...
AAF93343      82 STFHTLGLNIIRREFKALGLKAGFSLFDDQDQLALLKELTEKQLDGDKDLLRLLLSTISNWKNDMLTPPQAKAMAKGEQQ 161 Vibrio cholerae...
1UAA_A       162 RIFAHCYGLYDAHLKACNVLDFDDLILLPTLLLQANEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVGSRARFTVVG 241 Escherichia col...
P09980       162 RIFAHCYGLYDAHLKACNVLDFDDLILLPTLLLQRNEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVGSRARFTVVG 241 Escherichia col...
AAF33474     162 RIFAHCYGLYDAHMKACNVLDFDDLILLPTLLLQRNDEVRERWQNKIRYLLVDEYQDTNTSQYELVKLLVGQRARFTVVG 241 Salmonella ente...
P44804       162 QTFAKCYERYATQIRTYNALDFDDLIMLPTLLFKQNEEVRSKWQAKIRYLLVDEYQDTNTSQYELIKLLVGDRACFTVVG 241 Haemophilus inf...
AAF85477     182 MEVATLYARYQARLIAFNAVDFDDLIRLPVQILETSDQVAMAWRERIGYLLVDECQDTNDAQYRLLKVLASPRGNFTCVG 261 Xylella fastidi...
AAG08681     162 QTAAIVYLHYQRTLRAYNAVDFDDLILQPVKLFQEHPDVLQKWQNKVRYMLVDEYQDTNASQYLLVKLLVKDRAQFTVVG 241 Pseudomonas aer...
O51889       162 KDFAFFYKQYTFHLRKSNILDFDDLICIPTSLLKNNQIIQNRWQKKISYLLVDEYQDTNNSQYELIKMLTNVNSNFTLVG 241 Buchnera aphidi...
WP_002225110 160 QQTARVYASYQETLQSYQAVDFDDLIRLPAVLLQQNSEVRNKWQRRLRYLLVDECQDTNTCQFTLMKLLTGAEGMFTAVG 239 Neisseria menin...
AAF93343     162 LLFAHCFELYQKQMQSYNALDFDDLILLPVLLLRSNEEVRQRWQNRIRYLLVDEYQDTNTSQYELVKLLVGERGRLTVVG 241 Vibrio cholerae...
1UAA_A       242 DDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEE 321 Escherichia col...
P09980       242 DDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEE 321 Escherichia col...
AAF33474     242 DDDQSIYSWRGARPQNLVLLSQDFPALQVIKLEQNYRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEE 321 Salmonella ente...
P44804       242 DDDQSIYSWRGARPENMVRLRDDFPRLNVIKLEQNYRSTQRILHCANILIDNNEHVFDKKLFSTIGKGEKLLVIEAKNEE 321 Haemophilus inf...
AAF85477     262 DDDQSIYAWRGANAENLLQLERDYPQLKVIKLEQNYRCPNRVLRAANALIAHNPHAHLKTLWSDQKDGERIRIWECRDSE 341 Xylella fastidi...
AAG08681     242 DDDQSIYAWRGARPENLMQLKEDFPSLKVVMLEQNYRSTSRILKCANVLIANNPHVFEKQLWSEMGHGDPIRVIRCRNED 321 Pseudomonas aer...
O51889       242 DDDQSIYSWRGAKPQNLFLIKKDFPNLKIIKMEQNYRSYGRILKAANKLISNNLHYFKKKLFSNLEYGNKIKVIIGKNEK 321 Buchnera aphidi...
WP_002225110 240 DDDQSIYAWRGANMENLRKMQENYPQMKVIKLEQNYRSTARILKIANKVIENNPKLFTKKLWSQLGEGEPVKVVACQNEQ 319 Neisseria menin...
AAF93343     242 DDDQSIYSWRGAKPQNLVLLGEDFPSLKLIKLEQNYRSTSRILRAANILIANNPHVYQKALFSELAEGEKLKVILANNED 321 Vibrio cholerae...
1UAA_A       322 HEAERVTGELIAHHFVN--KTQYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD 399 Escherichia col...
P09980       322 HEAERVTGELIAHHFVN--KTQYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD 399 Escherichia col...
AAF33474     322 HEAERVTGELIAHHFVN--KTQYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD 399 Salmonella ente...
P44804       322 HEAERIVAELIAHRFSR--KTKYKDYAILYRGNHQSRLLEKVLMQNRIPYKISGGTSFFSRAEIKDMMAYLRLVVNQDDD 399 Haemophilus inf...
AAF85477     342 HEAEKIAGEIS--YLGDakQVPWSDFCILFRGNFQSRPLEKALQLLRIPYHLTGGTAFLERQEVKNLLSWLRLLVNPDDD 419 Xylella fastidi...
AAG08681     322 AEAERIAMEIL--TLHLrtERPYSEFAILYRGNHQAKLMELKLQHHQIPYRLSGGTSFFGRQEVKDLMSYFRLLVNPDDD 399 Pseudomonas aer...
O51889       322 NEAEKIADKIIHECSND--IMQYKDYAILYRGNYQSQILEKTFLKKNIPYDISTNSSFFSRPEIKDLLSYLRLIVNPDDN 399 Buchnera aphidi...
WP_002225110 320 HEADWVVSQIVKQKLIGgdKTQYADFAVLYRGKHQARIFEEALRGARIPYQLSGGQSFFDKAEIKDVLSYVRLLANPNDD 399 Neisseria menin...
AAF93343     322 HEAERVIAEIIAHKFLN--RTEYRDYAILYRGNHQSRLIEKSLTQNRVPYKLSGGTSFFARAEIKDIMAYLRVLVNPDDD 399 Vibrio cholerae...
1UAA_A       400 SAFLRIVNTPKREIGPATLKKLGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTHWLAEIQRLAER-EPIAAVRDL 478 Escherichia col...
P09980       400 SAFLRIVNTPKREIGPATLKKLGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTHWLAEIQRLAER-EPIAAVRDL 478 Escherichia col...
AAF33474     400 SAFLRIVNTPKREIGPATLQKLGEWAMTRNKSLFTASFDMGLSQKLTGRGYDSLTRFTHWLGEIQRLAER-EPVAAVRDL 478 Salmonella ente...
P44804       400 AAFLRIVNTPKREIGTATLQKLGELAQEKHISLFEAIFEFELIQRITPKAYDSLQKFGRWIVELNDEIQRsEPERAVRSM 479 Haemophilus inf...
AAF85477     420 AAFLRAVQSPKREVGSTSLAKLAELAAAKQMPMSRAAESLGALQQLPARAANGLNKFTDILRELRQQVSRvSAAELVRRL 499 Xylella fastidi...
AAG08681     400 NAFLRVINVPRREIGSATLEKLGNYATQRKISMYAACDEMGLAEHLDSRFHERLQRFKRWMDGIRRQCAEnEPIAVLRSM 479 Pseudomonas aer...
O51889       400 HAFIRILNIPHRQIGLTTLNKLEELASKKNKSLFQISNDIEIKKILRERTVKKIKDFIYWIKKIIKLSLLkED-IILDKI 478 Buchnera aphidi...
WP_002225110 400 PAFLRAVTTPKRGIGDVTLGKLNTYAHEHECSLYEAAQNEEALATLNNTNRQHLQTFMDMFVSYLAKAETsEAGEFINSL 479 Neisseria menin...
AAF93343     400 NAFLRIVNTPKREIGPATLEKLGSYANMRGKSLFTASFELGLEQHLSGRGLENLRRFTEWLVAIADNAERgNTVEAVRAL 479 Vibrio cholerae...
1UAA_A       479 IHGMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGSELDEP-MTLTQVVTRFTLRDMMERG--ESEEELDQVQLM 555 Escherichia col...
P09980       479 IHGMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGSELDEP-MTLTQVVTRFTLRDMMERG--ESEEELDQVQLM 555 Escherichia col...
AAF33474     479 IHGIDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGNELDEP-MTLTQVVTRFTLRDMMERG--ESEEELDQVQLM 555 Salmonella ente...
P44804       480 LSAIHYEEYLYEYATSPKAAEMQSKNVATLFDWVADMLKGDETNEP-MNLNQVVTRLTLRDMLERG--EDDDDSDQVQLM 556 Haemophilus inf...
AAF85477     500 AEVSGLLTELREQSNDEASYQRRKRNVEELAEWFE-----GGPFGA--SVGDLVSQLALLSRND-----KDDGGNQVRMM 567 Xylella fastidi...
AAG08681     480 VMDIDYENWLRQNASSDKVAEFRMSNVWFLIEALKNTLERDEEGDM--TIEQAIAKLVLRDMLERQq-EEEEGAEGVQMM 556 Pseudomonas aer...
O51889       479 INDIKYELWLTKILKEPKKIKTSINNIYTLSNWLKEMLRGNEFEKP-MNLLQIVKKMTLRDILEKKiqINEIPKNRVQLM 557 Buchnera aphidi...
WP_002225110 480 LEEIDYENHLMQNEEGKAG-EIKWRNVGDLVSWFAR---KGGEDGK--NIIELAQTVALMTLLEGK---DEEETDAVSLS 550 Neisseria menin...
AAF93343     480 VRDIRYEDWLYETSASPKAAEMRMKNVSDLYSWIVADLEGDNPDQQeKTLKEVVQRLTLRDMMERG--EENDDSDAVQLM 557 Vibrio cholerae...
1UAA_A       556 TLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIDEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ 635 Escherichia col...
P09980       556 TLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIDEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ 635 Escherichia col...
AAF33474     556 TLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIEEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ 635 Salmonella ente...
P44804       557 TLHASKGLEFPYVYLIGMEEGILPHQTSIDEDNVEEERRLAYVGITRAQKELTFSLCRERRQYGELVRPEPSRFLAELPN 636 Haemophilus inf...
AAF85477     568 TLHASKGLEFRYVFIAGCEDGVLPHEVSLEEGNVQEERRLLYVGITRAKEQLWMSYSKCARRFGERVRFKPSRFFDELPA 647 Xylella fastidi...
AAG08681     557 TLHASKGLEFPYVFIMGMEEEILPHRSSIEADTVEEERRLAYVGITRARQNLAMTFAAKRKQYGEIIDCSPSRFLDELPP 636 Pseudomonas aer...
O51889       558 TLHSSKGLEFSSVFIIGMNEGILPNIKSINNDNIEEERRLTYVGMTRARKELFFTYCQTRIQYGQKLYTAPSRFLFELPQ 637 Buchnera aphidi...
WP_002225110 551 TLHAAKGLEYPYVFLVGCEEGVLPHNDSIEEGNVEEERRLMYVGITRAKRQLTLTHCVKRKKQGTWQFPEPSRFIDEMPQ 630 Neisseria menin...
AAF93343     558 TLHASKGLEFPYVYLIGAEEGILPHQTSIDEENVEEERRLMYVGITRAQRELTFIVCKERRQFGELIKPSQSRFLDELPQ 637 Vibrio cholerae...
1UAA_A       636 DDLI---WEQERKVVSAEERMQKGQSHLANLK 664 Escherichia coli str. K-12 substr. MG1655
P09980       636 DDLI---WEQERKVVSAEERMQKGQSHLANLK 664 Escherichia coli K-12
AAF33474     636 DDLI---WEQERKVVSAEERMQKGQSHLANLK 664 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
P44804       637 DDVL---WERDKPKLTTEQKQEKTQNQLDRLR 665 Haemophilus influenzae Rd KW20
AAF85477     648 EELQ---RDGADPVVDAERKQERAKAGLAAIQ 676 Xylella fastidiosa 9a5c
AAG08681     637 EDLE---WEGMEDAP-QEVKAAKGNAALADIR 664 Pseudomonas aeruginosa PAO1
O51889       638 EDLQ---WEKDDYLDAFHTKEKki-------- 658 Buchnera aphidicola str. Sg (Schizaphis graminum)
WP_002225110 631 EDLKilgRKGGEPIVSKEEGRRNLADIIGRLD 662 Neisseria meningitidis
AAF93343     638 DDIE---WEVKKKPVTQEERMAKGQAHIANLR 666 Vibrio cholerae O1 biovar El Tor str. N16961
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap