2RL1,2YVW


Conserved Protein Domain Family
murA

?
TIGR01072: murA 
Click on image for an interactive view with Cn3D
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
[Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 162190
View PSSM: TIGR01072
Aligned: 19 rows
Threshold Bit Score: 596.132
Threshold Setting Gi: 7674124
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2RL1_A         1 MDKFRVYGQSRLSGSVNISGAKNAALPILFAAILATEPVKLTN-VPELKDIETTLKILRQLGVVVDRDA-TGaVLLDASN 78  Haemophilus inf...
O84461         1 MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKN-VPNIEDVRQTVDLCRVLGAIVEWDQqAQvIEIHTPR 79  Chlamydia trach...
Q55673        14 QTVIEIEGRASLKGEVRISGAKNSALAIMAGTILCSDDCRLSN-LPALADIDKMCQILAAIGVNLERDG-DR-LVVDSSN 90  Synechocystis s...
Q9WXW3         1 MGKLVVQGGAVLEGEVEISGSKNAALPIMAAAILCDEEVILKN-VPRLQDVFVMIDILRSIGFRVEFEE-NE-LKIKREN 77  Thermotoga mari...
P19670         1 MEKLNIAGGDSLNGTVHISGAKNSAVALIPATILANSEVTIEG-LPEISDIETLRDLLKEIGGNVHFEN-GE-MVVDPTS 77  Bacillus subtil...
Q10604         2 AERFVVTGGNRLSGEVAVGGAKNSVLKLMAATLLAEGTSTITN-CPDILDVPLMAEVLRGLGATVELDG-DV-ARITAPD 78  Mycobacterium t...
Q9RVA6         3 LTPLHVTGGRQLGGEIAVQHSKNAALPIIVATLLSSEPITLHG-IPRLSDVYTILELMHHLGTRHAWVGpNS-LTLHTPE 80  Deinococcus rad...
O51428         1 MHSYIVEGGYKIGGQITASGNKNAALPCILAALLTDEEVILEN-IPNINDVKVVLDILNDIGADIAREG-Nt-LKIKVLN 77  Borrelia burgdo...
WP_003227695   1 MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICdVPTLSDVYTINEVLRHLGADVHFEN-NE-VTVNASY 78  Bacillus
Q9Z7Y2         1 MQIAQVFGCGRLNGEVKVSGAKNAATKLLVASLLSDQKCTLRN-VPDIGDVSLTVELCKSLGAHVSWDKeTEvLEIYTPE 79  Chlamydia pneum...
2RL1_A        79 INHFTAPYELVKTMRASIWALAPLVARFHQ-GQVSLPGGCSIGARPVDLHISGLEKLGADIVLEEGYVKAQVSD---RLV 154 Haemophilus inf...
O84461        80 ILLSKVPPQFSCVNRIPILLLGALLRRCPYgIFVPILGGDAIGPRTLHFHLEGLKKLGAEIVISDEGYWASAPN---GLV 156 Chlamydia trach...
Q55673        91 VGHGPAPYELVSQLRASFFVIGPLLSRLGM-TKVPLPGGCAIGTRPVDLHVRGLQAMGADVHIEHGVVNASIKGhsrRLT 169 Synechocystis s...
Q9WXW3        78 DISQEVPYELVRKMRASFNVLGPIAVRTGR-AKVALPGGCSIGVRPVDFHLEGLKKMGFSIKVEHGFVEACFER---RID 153 Thermotoga mari...
P19670        78 MISMPLPNGKVKKLRASYYLMGAMLGRFKQ-AVIGLPGGCHLGPRPIDQHIKGFEALGAEVTNEQGAIYLRAE----RLR 152 Bacillus subtil...
Q10604        79 EPKYDADFAAVRQFRASVCVLGPLVGRCKR-ARVALPGGDAIGSRPLDMHQAGLRQLGAHCNIEHGCVVARAE----TLR 153 Mycobacterium t...
Q9RVA6        81 IENTDAPYALVSKMRASFIVLGAILARAGT-ATVSMPGGCAWGPRPVDQHVKALRALGAEVIEDGGNFFAHREG---SLN 156 Deinococcus rad...
O51428        78 IVKTEIDSSFTDLIRASILLLGPFVSRFGK-IDMALPGGDVIGKRRLDTHFYGLCKLGAKLSTKDRRIVLKAN----KLV 152 Borrelia burgdo...
WP_003227695  79 ALQTEAPFEYVRKMRASVLVMGPLLARTGH-ARVALPGGCAIGSRPIDQHLKGFEAMGAEIKVGNGFIEAEVKG---RLQ 154 Bacillus
Q9Z7Y2        80 IQCTRVPPTFSNVNRIPILLLGALLGRCPEgVYVPTVGGDAIGERTLNFHFEGLKQLGVQISSDSSGYYAKAPR---GLK 156 Chlamydia pneum...
2RL1_A       155 GTRIVIEKVSVGATLSIMMAATLAKGT-TVIENAAREPEIVDTADFLNKMGAKITGAGSAHITIEGVERLTGCEHSVVPD 233 Haemophilus inf...
O84461       157 GAHITLPYPSVGATENLILASVGAQGR-TIIKNAALEVEIIDLIVFLQKAGVEITTDNDKTIEIFGCQDFYSVEHSIIPD 235 Chlamydia trach...
Q55673       170 GAKIYLDYPSVGATETILMAATLAEGE-TVIDNAAREPEIVDLANFCRSMGAQIRGDGSSRIIINGVEKLHSTDFPIIPD 248 Synechocystis s...
Q9WXW3       154 YVTITLPFPSVGATEHLMTTAALLKGArVVIENAAMEPEIVDLQNFINRMGGHIEGAGTSRIVIEGVEKMQGVEYSIIPD 233 Thermotoga mari...
P19670       153 GARIYLDVVSVGATINIMLAAVLAEGK-TIIENAAKEPEIIDVATLLTSMGAKIKGAGTNVIRIDGVKELHGCKHTIIPD 231 Bacillus subtil...
Q10604       154 GAEIQLEFPSVGATENILMAAVVAEGV-TTIHNAAREPDVVDLCTMLNQMGAQVEGAGSPTMTITGVPRLHPTEHRVIGD 232 Mycobacterium t...
Q9RVA6       157 GS-FVFELLTVGGTHNAILAAALGEGT-VTLENASIDTDVVDVIEFLNALGARIEGAGTNTITIHGVKELHGGEYTVIPD 234 Deinococcus rad...
O51428       153 GAEMFLDEASVTATENIIMAAVLAEGN-TVIMNAACEPHVQDLCNMLNSMGANILGIGSNVLEIKGVKKLSGTVFRIGAD 231 Borrelia burgdo...
WP_003227695 155 GAKIYLDFPSVGATENLIMAAALAEGT-TTLENVAKEPEIVDLANYINGMGGKIRGAGTGTIKIEGVEKLHGVKHHIIPD 233 Bacillus
Q9Z7Y2       157 GNYIHLPYPSVGATENLILAAIHAKGR-TVIKNVALEAEILDLVLFLQKAGADITTDNDRTIDIFGTGGLGSVDHTILPD 235 Chlamydia pneum...
2RL1_A       234 RIETGTFLIAAAISGGCVVCQNTKADTLDAVIDKLREAGAQVDVTE-NSITLDMLG-------NRPKAVNIRTAPHPGFP 305 Haemophilus inf...
O84461       236 KIEAASFGMAAVVSQGRIFVEQARHEHMIPFLKVLRSIGGGFSVHE-NGIEFFYDK-------PLKGGVLLETDVHPGFI 307 Chlamydia trach...
Q55673       249 RIEAATFLCAGAITHSEISLFPVVPDHLASAIAKLREIGPEVAIDApDRVRLIPR---------DLRGTDIETLPYPGFP 319 Synechocystis s...
Q9WXW3       234 RIEAGTYLVAIAASRGKGLVKNVNPDHLTNFFEKLEETGAKLKVLG-NEVEIEMR--------ERPKAVDVTTNPYPGFP 304 Thermotoga mari...
P19670       232 RIEAGTFMIAGAAMGKEVIIDNVIPTHLESLTAKLREMGYHIETSD-DQLLIVGGQ-------KNLKPVDVKTLVYPGFP 303 Bacillus subtil...
Q10604       233 RIVAATWGIAAAMTRGDISVAGVDPAHLQLVLHKLHDAGATVTQTD-ASFRVTQY--------ERPKAVNVATLPFPGFP 303 Mycobacterium t...
Q9RVA6       235 RIEAGTFMMLAAATRSRLTLTNVRPDHLRAVTSKLAEMGVDIQEDG-NRMVVDARG-------RDLKPVNVTTQSYPGFP 306 Deinococcus rad...
O51428       232 FMQVGSLISLAALTGGELEIKKADPQHFRLIRHVYSRLGINFEYDR-ENVYVRNKQelkvkldFGGHIPKIDDGPWPAFP 310 Borrelia burgdo...
WP_003227695 234 RIEAGTFMVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVTIKDEG-EGLRVIG-P-------KELKPIDIKTMPHPGFP 304 Bacillus
Q9Z7Y2       236 KIEAASFGMAAVVSGGRVFVRNAKQELLIPFLKMLRSIGGGFLVSE-SGIEFFQER-------PLVGGVVLETDVHPGFL 307 Chlamydia pneum...
2RL1_A       306 TDMQAQFTLLNMVAEGTSIITETIFENRFMHIPELIRMGGKAEIE----------------GNTAVCHGVEQLSGTEVIA 369 Haemophilus inf...
O84461       308 TDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCDLFheclsakscrystgnhPHSAVIHGPTPLQATDLVI 387 Chlamydia trach...
Q55673       320 TDMQAQFMALLAVSEGNSVVTETVFENRLQHVAELQRMGANIKLK----------------GNAAFIQGVPFLSGAPVMS 383 Synechocystis s...
Q9WXW3       305 TDLQPQMMAYLSTASGVSVITENVFKTRFLHVDELKRMGADIEVS----------------GNVAIVKGVEKLSGAPVEG 368 Thermotoga mari...
P19670       304 TDLQQPMTALLTRAKGTSVVTDTIYSARFKHIDELRRMGANMKVE----------------GRSAIITGPVELQGAKVKA 367 Bacillus subtil...
Q10604       304 TDLQPMAIALASIADGTSMITENVFEARFRFVEEMIRLGADARTD----------------GHHAVVRGLPQLSSAPVWC 367 Mycobacterium t...
Q9RVA6       307 TDLQPQMSALLATVPGTSVIQDPVYPDRLTHVAELHRMGATITVS----------------GYTQVIQG-GTLHAAPVKA 369 Deinococcus rad...
O51428       311 TDLMSIIVVTATQVEGTVLVFEKMFESRMFFVDKLIKMGARIVLCd---------------PHRVVVTGKSSLKGNVLSS 375 Borrelia burgdo...
WP_003227695 305 TDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIE----------------GRSVIINGPVQLQGAEVAA 368 Bacillus
Q9Z7Y2       308 TDWQQPFAVLLSQAQGSSVIHETVHENRLGYLHGLQHMGAECQLFhqclstkacryaignfPHSAVIHGATPLWASHLVI 387 Chlamydia pneum...
2RL1_A       370 TDLRASISLVLAGCIATG-ETIVDRIYHIDRGYEHIEDKLRGLGAKIER 417 Haemophilus influenzae Rd KW20
O84461       388 PDLRAGFAYVMAALIAEGgASWIENTEMLDRGYTDWRGKLERLGAKVLA 436 Chlamydia trachomatis D/UW-3/CX
Q55673       384 TDLRASAALVIAGLAAEG-KTIVQGLRHLDRGYEDIEGKLRKLGAKLTR 431 Synechocystis sp. PCC 6803 substr. Kazusa
Q9WXW3       369 TDLRATAALLIAGIIADG-VTEISNVEHIFRGYEDVIDKFSELGAKIEY 416 Thermotoga maritima MSB8
P19670       368 SDLRAGACLVVAGLMADG-VTEITGLEHIDRGYSSLEKKLEGLGATIWR 415 Bacillus subtilis subsp. subtilis str. 168
Q10604       368 SDIRAGAGLVLAGLVADG-DTEVHDVFHIDRGYPLFVENLVSLGAEIER 415 Mycobacterium tuberculosis
Q9RVA6       370 ADLRAGAALFIAGLTCEG-ETVIDGVQYLNRGYERLAERLRGIGGEVMQ 417 Deinococcus radiodurans R1
O51428       376 PDVRAGMSLLIAAFVAEG-RSEIQNVYQIERGYEDVVNKLINLGAKIKK 423 Borrelia burgdorferi B31
WP_003227695 369 TDLRAGAALILAGLVAEG-HTRVTELKHLDRGYVDFHQKLAALGADIER 416 Bacillus
Q9Z7Y2       388 PDLRAGFAYVMAALIAEGgGSIIENTHLLDRGYTNWVGKLRSLGAKIQI 436 Chlamydia pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap