Conserved Protein Domain Family
mutS2

?
TIGR01069: mutS2 
MutS2 family protein
Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function. [DNA metabolism, Other]
Statistics
?
PSSM-Id: 130141
View PSSM: TIGR01069
Aligned: 5 rows
Threshold Bit Score: 879.923
Threshold Setting Gi: 3914057
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P94545   1 MQQKVLSALEFHKVKEQVIGHAASSLGKEMLLELKPSASIDEIKKQLDEVDEASDIIRlr-gQAPFGGLVDIRGALRRAE 79  Bacillus subtilis sub...
P73625   9 IAEETLALLEWPRLCQHLSTFTQTPLGAIAARYLLPPSQWEESRELLAQTQAVESIENspesNWHFKGIADITEPLARVE 88  Synechocystis sp. PCC...
O67287   1 MREKDLIKLEFDKVKEVLASYAHSPATKEKIQNLKPYTNKEKVKEEIELSKAFFDIAE----NVRLFEFEDIRELLKKAK 76  Aquifex aeolicus VF5
O51125  35 snqkilktkeslekifsfvslirmlfesckgypnsfinslkypisllLKENSRVSIEN---------------------- 92  Borrelia burgdorferi B31
O25338  37 lfktffakerdtiALENDLKQTFTYLNEVDAIGLPTPKSVKESDLIIIKLTKLGTLHL---------------D-----E 96  Helicobacter pylori 2...
P94545  80 IGSVLSPSE-FTEISGLLYAVKQMKhfitQMAEDGVDIPLIHQHAEQLITLSDLERDINSCIDDHGEVLDH-ASETLRGI 157 Bacillus subtilis sub...
P73625  89 RGGLVTGLE-LLAIAGTLAGVRRLR----RVIEERDDLEILQTLVAEVRTLPELEQAIHHCLGEDGKVAER-ASPKLGEI 162 Synechocystis sp. PCC...
O67287  77 LQGAILGVEdILKILNVINLTKEIRr---VLSSHVQRLEPLRKVYKKLYTFSPLENLIIGSIDPRGFVKDE-ASEELLRV 152 Aquifex aeolicus VF5
O51125  93 LRDIIVFLDeVLRINLFLHKNSDIK-------H--LNVQILSDLLFLNPELKNLLNELKEHIDVDALELKSgVVKEYDSI 163 Borrelia burgdorferi B31
O25338  97 IFEIVKRLHyIVVLQNAFKTFTHLK----------------FHERLNAIVLPPFFNDLIALFDDEGKIKQG-ANATLDAL 159 Helicobacter pylori 2...
P94545 158 RTQLRTLESRVRDRLESMLRSSsaSKMLSDTIVTIRNDRFVIPVKQEYRSSYGGIVHDTSSSGATLFIEPQAIVDMNNSL 237 Bacillus subtilis sub...
P73625 163 RQKLKAVREQIQQKLQKIIQRQ--SNALQEAVITQRGDRFVLPIKAGYKEQMPGIVHDSSASGNTLYVEPQAIVELGNKL 240 Synechocystis sp. PCC...
O67287 153 RKSIRAVEEEIKKRLDNLINRPdsAKFLSDRIVTIRNGRYVIPVKTSHVKKIFGIVHGTSSSGYTTYVEPQFVIHLNNKL 232 Aquifex aeolicus VF5
O51125 164 EFEIKNLNRRVENQIKKIISLN--AEYLTSNFVCYKSNKYTLALKSNFKGKIKGNIISISSSGETFYIEPNDIVNANNRL 241 Borrelia burgdorferi B31
O25338 160 NESLNRLKKESVKIIHHYARSKelAPYLVDTQSHLKHGYECLLLKSGFSGAIKGVVLERSANG-YFYLLPESAQKIAQKI 238 Helicobacter pylori 2...
P94545 238 QQAKVKEKQEIERILRVLTEKTAEYTEELFLDLQVLQTLDFIFAKARYAKAVKATKPIMNDTG---FIRLKKARHPLLPP 314 Bacillus subtilis sub...
P73625 241 RQARRQEQTEEERILRQLSDQVLEVLLDLEHLLAIATRLDLATARVRYSFWLGAHPPQWLTPGdekPITLRQLRHPLLHW 320 Synechocystis sp. PCC...
O67287 233 TELKQKEEEEVRKVLQRITEYIGDYAKELLESFEACVEVDFQQCKYRFSKLVEGSFPDFGe-----WVELYEARHPVLVL 307 Aquifex aeolicus VF5
O51125 242 NYLSLEKERIILKILRNLSAKVHSNIVLLDNLYNNFLYYDSLKARAIYGIKTKGVFPEISN-----VLNIFDAHHPLLKD 316 Borrelia burgdorferi B31
O25338 239 AQIGNEIDCCIVEMCQTLSHSLQKHLLFLKFLFKEFDFLDSLQARLNFAKAYNLEFVMPSFTq--kKMILENFSHPILKE 316 Helicobacter pylori 2...
P94545 315 DQ-------VVANDIELGRDFSTIVITGPNTGGKTVTLKTLGLLTLMAQSGLHIPADEG-SEAAVFEHVFADIGDEQSIE 386 Bacillus subtilis sub...
P73625 321 QAekeggpaVVPITLTIDSQIRVIAITGPNTGGKTVTLKTLGLVALMAKVGLYIPAKET-VEMPWFAQILADIGDEQSLQ 399 Synechocystis sp. PCC...
O67287 308 VKe-----dVVPVGILLK-EKKGLILTGPNTGGKTVALKTLGLSVLMFQSAIPVPASPN-SKLPLFEKVFTDIGDEQSIE 380 Aquifex aeolicus VF5
O51125 317 SK-------AITFTPAEN---RVVIITGPNAGGKTVTLKTIGLLSAMFQFGIPIVVGES-STFKIFDNIFIDIGDEQSIS 385 Borrelia burgdorferi B31
O25338 317 PK-----------PLNLKFEKSMLAVTGVNAGGKTMLLKSLLSAAFLSKHLIPMKINAHhSIIPYFKEIHAIINDPQNSA 385 Helicobacter pylori 2...
P94545 387 QSLSTFSSHMVNIVGILEQVNE------------------NSLVLFDELGAGTDPQEGAALAMSILDDVHRTNARVLATT 448 Bacillus subtilis sub...
P73625 400 QNLSTFSGHICRIIRILQALPSgvqdvldpeidspnhpifPSLVLLDEVGAGTDPTEGSALAIALLRHLADQPCLTVATT 479 Synechocystis sp. PCC...
O67287 381 QNLSTFSAHVKNMAEFLPKSDE------------------NTLVLIDELGAGTDPIEGSALGIGILEYLKKKKAWVFVTT 442 Aquifex aeolicus VF5
O51125 386 NSLSTFSSHMSNISYILKHTTK------------------DSLVIFDEFCSGTDIDQGQALAISILEYLININSYVLIST 447 Borrelia burgdorferi B31
O25338 386 NNISTFAGRMKQFSALLSK--E------------------NMLLGVDEIELGTDADEASSLYKTLLEKLLKQNNQIIITT 445 Helicobacter pylori 2...
P94545 449 HYPELKAYGYNREGVMNASVEFDIETLSPTYKLLIGVPGRSNAFEISKRLGLPDHIIGQAKSEMTAEHNEVDTMIASLEQ 528 Bacillus subtilis sub...
P73625 480 HYGELKALKYQDARFENASVEFDDQSLSPTYRLLWGIPGRSNALAIAQRLGLPLAIVEQAKDKLGGFSEDINQVIAGLES 559 Synechocystis sp. PCC...
O67287 443 HHTPIKLYSTNSDYYTPASVLFDRETLKPLYKIAYNTVGESMAFYIAQKYGIPSEVIEIAKRHVGEFGEQYIKAMEKLSD 522 Aquifex aeolicus VF5
O51125 448 HYNALKYFAYTHEGVVNASMRMDLETMQPNYNLIFSIPGESYAFNVASKALIDRSIVIRANEIYSSQKTEINEILEKLIE 527 Borrelia burgdorferi B31
O25338 446 HHKRLSVLMAENKEVELLAALYDEEKERPTYTFLKGVIGKSYAFETALRYGVPHFLIEKAKTFYGEDKEKLNVLIENSSA 525 Helicobacter pylori 2...
P94545 529 SKKRAEEELSETESIRKEAEKLHKELQQQIIELNSKKDKMLEEAEQQAAEKVKAAMKEAEDIIHELRTIK-EEHKSFKDH 607 Bacillus subtilis sub...
P73625 560 QRREQEQKAANAQKLLQETEIFYQQVSQKAASLQARERELKSYQDQEVQQAIAAAKEEIAKVIRQLQRGKpSAQKAQQAT 639 Synechocystis sp. PCC...
O67287 523 YVKKYEEEFRKLEELRKELQKEKEEVEKLRKEYEEAKRKGWKEAYKEAREYLRKLVQESEEIFKKAKEKKeIKEFVSK-- 600 Aquifex aeolicus VF5
O51125 528 KEKDLLLIKESMDKKLIQIELQEKELENFYQDLLLREKNIETKLLNEQNEFLKNSRKVLENLVREIKEGNiNVAKNKAFI 607 Borrelia burgdorferi B31
O25338 526 LERELKQKNEHLENALKEQEYLKNAWLLEMEKQKEIFHNKKLELEKSYQQALNILKSEVASKDTSSMHKEiHKASEILS- 604 Helicobacter pylori 2...
P94545 608 ELInakKRLEgampaFEKSKKPEKPKTQKRdfKPGDEVKVLTFGQKGTLLEKTG-GNEWNVQIGILKMKVKEKDLEFIKS 686 Bacillus subtilis sub...
P73625 640 EIL---GQIQa----EQKAKVAPKPIGYQP--TVGERIRIPSFGQTAEVTQVNAtAQTVNVTLGLMKMTVPMADIESLNG 710 Synechocystis sp. PCC...
O67287 601 -------KRE-----EIENLAPQKPQKLEVg------DLVEFMGKKGKVLEVKG--NKALVLVDHLRMWLDTRELQKVGK 660 Aquifex aeolicus VF5
O51125 608 SDLeknVDLK-----TNKVNSLNNKRNVVAdfKIGDKVRIVNSNAKGKIVGISK--KKITVNVGAFNVSVSSSEISLENF 680 Borrelia burgdorferi B31
O25338 605 -------KHK------TNQEIPQIITNFQAn------EKARYKNESVLIVQILDkGYYWIETELGMRLKAHGSLLKKIQK 665 Helicobacter pylori 2...
P94545 687 ---APEPKKEKMITAVKGKD------------YHVSLELDLRGERYENALSRVEKYLDDAVLAGypRVSIIHGKGTGALR 751 Bacillus subtilis sub...
P73625 711 kkvEPPPKSEPVPKKVKAEPpateaksppvlvRTEKNTLDCRGDRLERAESRLEKALNQALDAG--VLWIIHGKGTGKLR 788 Synechocystis sp. PCC...
O67287 661 ---AEPQKETKVTVQTPVME--------------KRDTLNLIGKDVETAVRELEKFIEEAYSAGykVVKVIHGIGSGKLK 723 Aquifex aeolicus VF5
O51125 681 kekKENGKNFNFSIDYNKEN-------------LLSFTIDIRGMRSVDALDFLNKKIDNIILNGinKFEIIHGKGEGHLM 747 Borrelia burgdorferi B31
O25338 666 ----PPKNKFKPPKTTIPKP------------KEASLRLDLRGQRSEEALDLLDAFLNDALLGGfeEVLICHGKGSGILE 729 Helicobacter pylori 2...
P94545 752 KGVQDLLKNHRSVKSSRFGEAGEGGSGVTVVELK 785 Bacillus subtilis subsp. subtilis str. 168
P73625 789 QGVQEYLSHHPLVKSYALAPQNDGGAGVTIAYLR 822 Synechocystis sp. PCC 6803 substr. Kazusa
O67287 724 SAVREALSKNEKVKFFRDAYPKEGGSGVTVVYLE 757 Aquifex aeolicus VF5
O51125 748 REVHNLLKELKFIRKYYFAHPSDGGSGKTIVei- 780 Borrelia burgdorferi B31
O25338 730 KFVKEFLKNHPKVVSFSDAPINLGGSGVKIVKL- 762 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap