Conserved Protein Domain Family

TIGR01069: mutS2 
MutS2 family protein
Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function. [DNA metabolism, Other]
PSSM-Id: 130141
Aligned: 5 rows
Threshold Bit Score: 879.923
Threshold Setting Gi: 3914057
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O51125  35 snqkilktkeslekifsfvslirmlfesckgypnsfinslkypisllLKENSRVSIEN---------------------- 92  Borrelia burgdorferi B31
O25338  37 lfktffakerdtiALENDLKQTFTYLNEVDAIGLPTPKSVKESDLIIIKLTKLGTLHL---------------D-----E 96  Helicobacter pylori 2...
P94545 752 KGVQDLLKNHRSVKSSRFGEAGEGGSGVTVVELK 785 Bacillus subtilis subsp. subtilis str. 168
P73625 789 QGVQEYLSHHPLVKSYALAPQNDGGAGVTIAYLR 822 Synechocystis sp. PCC 6803 substr. Kazusa
O51125 748 REVHNLLKELKFIRKYYFAHPSDGGSGKTIVei- 780 Borrelia burgdorferi B31
O25338 730 KFVKEFLKNHPKVVSFSDAPINLGGSGVKIVKL- 762 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap