Conserved Protein Domain Family
parC_Gneg

?
TIGR01062: parC_Gneg 
DNA topoisomerase IV, A subunit, proteobacterial
Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130134
View PSSM: TIGR01062
Aligned: 3 rows
Threshold Bit Score: 1221.68
Threshold Setting Gi: 7387992
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43702   9 IEQMPLRTFTEKAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKYKKSARTVGDVLGKFHPHGDSACYE 88  Haemophilus influenza...
P20082   5 AERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYE 84  Escherichia coli
Q9ZE79   6 IENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYD 85  Rickettsia prowazekii...
P43702  89 AMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKISEILLNELGQGTVDYQPNFDGTLAEPQYLPARLPHI 168 Haemophilus influenza...
P20082  85 AMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNI 164 Escherichia coli
Q9ZE79  86 TLVRLAQHFSLRYPLIDGQGNFGSIDG-DNAAAMRYTESRMTEICMLLMEDIDKDTVDFRSTYDDSDLEPVIMPASFPNL 164 Rickettsia prowazekii...
P43702 169 LLNGTTGIAVGMATDIPPHNINEIADAAVMLLDNPKAGLDDVLEIVQGPDFPTEAEIISPKSEIRKIYEQGRGSIKMRAT 248 Haemophilus influenza...
P20082 165 LLNGTTGIAVGMATDIPPHNLREVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAV 244 Escherichia coli
Q9ZE79 165 LANGSEGIAVGMATNIPPHNLHELCDALLYLIDNPQAGINDIMNFIKGPDFPTGGIIIDKAEVINAAYTTGRGSFRVRSR 244 Rickettsia prowazekii...
P43702 249 WKKEDG-----EIIISALPHQSSPSKVIAQIAEQMTAKKLPMLEDIRDEADHENPIRIVLVPRSNRVDTDALMAHLFATT 323 Haemophilus influenza...
P20082 245 WKKEDG-----AVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATT 319 Escherichia coli
Q9ZE79 245 WEKEELsygtyQIVVTEIPYQIQKSKLIEQIAILLKDKKIPLISSIRDES--TDIIRVVIEPRDRSCDPQIVMESLFKLT 322 Rickettsia prowazekii...
P43702 324 DLEKSYRVNMNMIGLDHKPAVKGLLEILNEWLDFRRTTVTRRLQYRLDKVLSRLHILEGLMIAFLNIDEVIEIIRHEDDP 403 Haemophilus influenza...
P20082 320 DLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEP 399 Escherichia coli
Q9ZE79 323 NLESRIQLNMNVIGSNNVPRVMNILEILQEFLVHRKNIIIRRSTYLLNKIKQRLEILKVLRIVYLNLDEIIEIIREEDEP 402 Rickettsia prowazekii...
P43702 404 KAELMARFNLSDEQADAILNLRLRHLAKLEENQLKAEQDELEKERLNLEAILGSERRLNTLIKKEIQEDAKKYAN----- 478 Haemophilus influenza...
P20082 400 KPALMSRFGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGD----- 474 Escherichia coli
Q9ZE79 403 KTIIMERFKISAIQVEVILNTRLRSLQKLEEHAIIDEHSNLQKQQAILEKILKNHKELWQIVKKEIKAVQTKFGLntiig 482 Rickettsia prowazekii...
P43702 479 PRMSQLVEREEAKMISES-DMTPAEPVTVILSEMGWVRCAKGHDIDPKSLSYKAGDSYLAHACGKSNQAVVFIDSTGRSY 557 Haemophilus influenza...
P20082 475 DRRSPLQEREEAKAMSEH-DMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSNQPVVFVDSTGRSY 553 Escherichia coli
Q9ZE79 483 ARRTSFEEVDLTNQVVDItAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDTEKFIIEAYTTDKILIISSKGRFF 562 Rickettsia prowazekii...
P43702 558 ALDPLSLPSARSQGEPLTGKLNLPTG-ATIEYVVMASEQQELLMASDAGYGFICKFEDLIARNKAGKALISLPENAKVLK 636 Haemophilus influenza...
P20082 554 AIDPITLPSARGQGEPLTGKLTLPPG-ATVDHMLMESDDQKLLMASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMP 632 Escherichia coli
Q9ZE79 563 TLLADNISKGKGTGG-VSIKLLVDIGnNDITNILVYKPNQLLLLASSIGKGFLVNSNEVIAQTKTGKQIMNIPEGYSCIA 641 Rickettsia prowazekii...
P43702 637 PKTLINSTALVVAITSAGRMLIFPAQDLPVLSKGKGNKMITIPAANAKDRSELLTKLLLISDQASLEFYSGKRKIVLKPE 716 Haemophilus influenza...
P20082 633 PVVIEDASDMLLAITQAGRMLMFPVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLTIHVGKRKIKLRPE 712 Escherichia coli
Q9ZE79 642 CLPVNGDS--IACIGESRRLLVFNIDEIPEMKKGQGVVLQRFK--NAK-----LLDIKIFNKQDGLSWNDG-TKIQLEKN 711 Rickettsia prowazekii...
P43702 717 DLQKFRAERGRKGsTLPRGLHTNLEIM 743 Haemophilus influenzae Rd KW20
P20082 713 ELQKVTGERGRRG-TLMRGLQRIDRVE 738 Escherichia coli
Q9ZE79 712 -IVAFLGKRGGFGtFPPIGFPKNNRFS 737 Rickettsia prowazekii str. Madrid E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap