Conserved Protein Domain Family
parE_Gpos

?
TIGR01058: parE_Gpos 
DNA topoisomerase IV, B subunit, Gram-positive
Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation step of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130130
View PSSM: TIGR01058
Aligned: 4 rows
Threshold Bit Score: 1106.85
Threshold Setting Gi: 1352716
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q59961     1 MSKKeininnYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHG 80  Streptococcus pneum...
Q59192     1 MARKqq--fdYNEDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEVLAGHGDHIIVKIHKDNSISVQDRG 78  Bacillus subtilis s...
AAF30878   1 MANK------YDGNAIKILEGLEAVRKRPGMYIGSTSSTGLHHLIWEIVDNSIDEVMNANAKNINVILHEDNSISVLDDG 74  Ureaplasma parvum s...
P47445     1 MKSN------YSATNIKILKGLDAVKKRPGMYIGSTDSKGLHHMLWEILANSVDEVLAGYATNITVTLDLNNTITVSDDG 74  Mycoplasma genitali...
Q59961    81 RGMPTGMHAMG-IPTVEVIFTILHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEITRDGAVYKQRFENGGKPVTTL 159 Streptococcus pneum...
Q59192    79 RGMPTGMHKLG-KPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLTVTIERDGFVYQQRFENGGKPVTSL 157 Bacillus subtilis s...
AAF30878  75 RGIPVDINSQTkISTVETVLTVLHAGGKFDESAYKTAGGLHGVGSSVVNALSSWLICEVYRDQKIYQAKFINGGHINQSL 154 Ureaplasma parvum s...
P47445    75 RGIPYEIHQDSnISTIDTVFTFLHAGGKFDDQSYKLAGGLHGVGASVVNALSDHLEVTVKRNGQIYQSVYQAGGKIIQKA 154 Mycoplasma genitali...
Q59961   160 KKIGTApkSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTNEAIEFHYENGVQDFVSYLNEDK 239 Streptococcus pneum...
Q59192   158 EKIGKT--KKTGTLTHFKPDPTMFSTTTYNFETLSERLRESAFLLKGLKIELIDERNDQREVFYYENGIEAFVAYLNEEK 235 Bacillus subtilis s...
AAF30878 155 KVIGTT--KKTGTLIHFLPDPLIFKNLVFNPNIIKERLHESTFLIKDLKIIFEDKINKKKYEFINNQGLIDFIKFINEAK 232 Ureaplasma parvum s...
P47445   155 KKIGDT--TSHGTTVSFHADPKVFKKAQFDSNIIKSRLKELSFLFAKLKLTFTDQKTNKTTVFFSTSGLVQFLDEINNTV 232 Mycoplasma genitali...
Q59961   240 EILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKVMNDYARKTGLLKEKDKNLEGSD 319 Streptococcus pneum...
Q59192   236 DVLSEVVSFEGEHHSIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHESGAKTAMTRAFNEYARKVALLKEKDKNLEGTD 315 Bacillus subtilis s...
AAF30878 233 KTFSDVIYFRSNINKIDVEIAFQYSDQNNEIMVSFANSVKTSEGGVHENAFKNALTSVVNNYARKHNLLKEKDKNLEGDD 312 Ureaplasma parvum s...
P47445   233 ETLGQKTLIKGEKDGIEVEVVFQFNQSDQETILSFANSIKTFEGGSHENGFCLAISDVINSYCRKYNLLKEKDKNFQLSE 312 Mycoplasma genitali...
Q59961   320 YREGLAAVLSILVPEEHLQFEGQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASNLIRKAIKARDAREAARKARDES 399 Streptococcus pneum...
Q59192   316 IREGLSAIISVRIPEELLQFEGQTKGKLGTSEARSAVDAIVSEQLAYFLEENRDTATLLVKKAIKASQAREAARKAREEA 395 Bacillus subtilis s...
AAF30878 313 IREGLSSVISLRIPESLISYEGQTKNKLFTPEANEAVKKTIEDNFSFWLEENKTQALDLVNRAILARDAKLAAKRAREET 392 Ureaplasma parvum s...
P47445   313 IRQGLNAIIKVNLPEKNIAFEGQTKSKLFSKEVKNVVYELVQQHYFQFLERNNNDAKLIIDKLLNARKIKEQIKQQRELK 392 Mycoplasma genitali...
Q59961   400 RNGKKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAK-MADILKNEEINT 478 Streptococcus pneum...
Q59192   396 RSGKKRKKSEATLSGKLTPAGSRNPAKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAK-LADIFKNEEINT 474 Bacillus subtilis s...
AAF30878 393 KKVKKIKEERG-MGGKLTPAQSKDPVLNELFLVEGDSAGGSAKLGRNKKYQAILPLRGKVLNVLKAR-LVDVLKNEEIAS 470 Ureaplasma parvum s...
P47445   393 KSLSSPQKEK-ILFGKLAPCQTKKTSEKELFIVEGDSAGGTAKMGRDRIFQAILPLRGKVLNVEKINnKKEAITNEEILT 471 Mycoplasma genitali...
Q59961   479 MIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKeeVAYA 558 Streptococcus pneum...
Q59192   475 IIHAIGGGVGADFSIDDINYDKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIEHGKVFIALPPLYKVSKGSGKKeiIEYA 554 Bacillus subtilis s...
AAF30878 471 IFTCLGTGIGAEFDLKKLKYHKIIIMTDADTDGSHIQVLLLTLFYRFMRPLIENGNIYIALPPLYKLTNKNNKK--FFYA 548 Ureaplasma parvum s...
P47445   472 LIFCIGTGILTNFNIKDLKYGKIIIMTDADNDGAHIQILLLTFFYRYMQPLIELGHVYLALPPLYKLETKDRKT--VKYL 549 Mycoplasma genitali...
Q59961   559 WTDGELEELRKQFgKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVK 638 Streptococcus pneum...
Q59192   555 WSDEEMGDVLKKVgKGYTIQRYKGLGEMNADQLWETTMNPESRTLVRVKIDDAARVERRVTTLMGDKVEPRRKWIEKNVA 634 Bacillus subtilis s...
AAF30878 549 WDDVELDQLKKEQ-KNYEIQRYKGLGEMNADQLFETTMDPNNRLLLKININDILQAERQINTLMGNDVSIRKQWIDNNID 627 Ureaplasma parvum s...
P47445   550 WSDLELESVKLKL-NNFTLQRYKGLGEMNADQLWDTTMNPTTRKLVQVKLDDLINAEKQINIFMGEKSDLRKHWIEANIN 628 Mycoplasma genitali...
Q59961   639 FTLEETTVF 647 Streptococcus pneumoniae TIGR4
Q59192   635 FGLDEESNI 643 Bacillus subtilis subsp. subtilis str. 168
AAF30878 628 FSVIDELQI 636 Ureaplasma parvum serovar 3 str. ATCC 700970
P47445   629 FSVEN---- 633 Mycoplasma genitalium G37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap