Conserved Protein Domain Family
parE_Gneg

?
TIGR01055: parE_Gneg 
DNA topoisomerase IV, B subunit, proteobacterial
Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason. This protein is active as an alpha(2)beta(2) heterotetramer. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130127
View PSSM: TIGR01055
Aligned: 3 rows
Threshold Bit Score: 1079.94
Threshold Setting Gi: 490736238
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43703         2 TTNYSAQEITVLKDLEPVQIRPGMYT---DTTRPNHLAQEVIDNSVDEALAGFATKIEVILHPDQSIEVTDNGRGMPVDI 78  Haemophilus inf...
P20083         2 TQTYNADAIEVLTGLEPVRRRPGMYT---DTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDI 78  Escherichia col...
WP_004598566  17 YTNYSAKDIEVLDGLEPVRKRPGMYIggtDSNAMHHLVSEVLDNAMDEAVAGFASIIMIKMHQDHSITIFDNGRGIPIDN 96  Rickettsia prow...
P43703        79 HPTE-GVSGVEVILTKLHAGGKFSNKNYEFAGGLHGVGISVVNALSERVDIQVKRNGEIYKIAFENGSKVEELEIIGTCG 157 Haemophilus inf...
P20083        79 HPEE-GVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCG 157 Escherichia col...
WP_004598566  97 HPKFpDKSALEVILTTLHSGSKFSNNVYHTSGGLHGVGISVVNALSKHFKIKVYKQGKLYSQSYSKGAKLTDLISAEAS- 175 Rickettsia prow...
P43703       158 RRTTGTIVHFKPNPKYFDS-AKFSVSRLRHLLRAKAVLCSGLEIKFIDKVNN-----TQDIWLYEDGLSDYLIEAVNGFE 231 Haemophilus inf...
P20083       158 KRNTGTSVHFWPDETFFDS-PRFSVSRLTHVLKAKAVLCPGVEITFKDEINN-----TEQRWCYQDGLNDYLAEAVNGLP 231 Escherichia col...
WP_004598566 176 KRLRGTSINFTPDPEIFSEkLHFNPKKIYEIARSKAYLYRGVSIEWECEVEVpsdipKKALINFPNGLKDYLSSKISLDN 255 Rickettsia prow...
P43703       232 TLPKKPFVGEFKG--ANEAVSWALLWLPEGGELIGESYVNLIPTIQGGTHVNGLRQGLLDAIREFCEFRNLLPRGVKLTA 309 Haemophilus inf...
P20083       232 TLPEKPFIGNFAG--DTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSA 309 Escherichia col...
WP_004598566 256 LVIPEIFSGNIEStvDDIKLEWAICWQNNDTSAFMQSYCNTVPTPQGGTHEQGLKSAILRGLKAYSEMIGNK-KAANLTI 334 Rickettsia prow...
P43703       310 DDIWDRCSYILSLKMQDAQFAGQTKERLSSRQSAVFVSGVLKDAFSLWLNQNVQDAEKLAEIAISSAQRR--LRAAKKVV 387 Haemophilus inf...
P20083       310 EDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRR--MRAAKKVV 387 Escherichia col...
WP_004598566 335 EDILETASIVLSIFIVEPSFQGQTKEKLVSNGVSKLVENIIKDHFDHFLSSDKVLATHLLEHVIAIAEFRrnKKNERNIS 414 Rickettsia prow...
P43703       388 RKKLVSGPALPGKLADCGSQDLEKTELFLVEGDSAGGSAKQARDREYQAILPLRGKILNTWEVSPDQVLGSTEIHDIAVA 467 Haemophilus inf...
P20083       388 RKKLTSGPALPGKLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVA 467 Escherichia col...
WP_004598566 415 RKSVTQKLRLPGKLADCTRTSAEGTELFIVEGDSAGGSAKQARNRETQAVLPLWGKVLNVASSTLEKIINNQAIQDLEIA 494 Rickettsia prow...
P43703       468 LGIDPDSND-LSQLRYGKVCILADADSDGLHIATLLCALFLRHFPKLVQDGHVYVAMPPLYRIDLNKEVFYALDENEKEA 546 Haemophilus inf...
P20083       468 IGIDPDSDD-LSQLRYGKICILADADSDGLHIATLLCALFVKHFRALVKHGHVYVALPPLYRIDLGKEVYYALTEEEKEG 546 Escherichia col...
WP_004598566 495 LACGSLKNYkKENLRYEKIIIMTDADVDGAHIASLLMTFFFLRMPKLVEEGHLYLAKPPLYRLTQSNKIYYACDEEEKIK 574 Rickettsia prow...
P43703       547 ILDRLKNK-KGKPNVQRFKGLGEMNPSQLRETTMDPNTRRLVQLTYDLGEDQGSDtlELMDMLLAKKRSEDRKNWLQA-- 623 Haemophilus inf...
P20083       547 VLEQLKRK-KGKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLTIDDEDDQRTD--AMMDMLLAKKRSEDRRNWLQE-- 621 Escherichia col...
WP_004598566 575 LTYKLSKAsKAKIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLEDVQN--VD--KIVDDLMGKK-PEKRFQFIYEqa 649 Rickettsia prow...
P43703       624 --KGDQV 628 Haemophilus influenzae Rd KW20
P20083       622 --KGDMA 626 Escherichia coli K-12
WP_004598566 650 lvKMDQI 656 Rickettsia prowazekii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap