1P6G


Conserved Protein Domain Family
rpsJ_bact

?
TIGR01049: rpsJ_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S10, bacterial/organelle
This model describes bacterial 30S ribosomal protein S10. In species that have a transcription antitermination complex, or N utilization substance, with NusA, NusB, NusG, and NusE, this ribosomal protein is responsible for NusE activity. Included in the family are one member each from Saccharomyces cerevisiae and Schizosaccharomyces pombe. These proteins lack an N-terminal mitochondrial transit peptide but contain additional sequence C-terminal to the ribosomal S10 protein region. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130121
View PSSM: TIGR01049
Aligned: 22 rows
Threshold Bit Score: 131.218
Threshold Setting Gi: 3116129
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P6G_J     4 QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKT 83  Escherichia coli
O66430     4 EKIRIKLRAYDHRLLDQSVKQIIETVKRTGGVVKGPIPLPTRKRKWCVLRSPHKFDQSREHFEIREFSRILDIIRFTPQT 83  Aquifex aeolicus VF5
P56017     2 EKIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQFEIRVYSRLIDIISATPET 81  Helicobacter pylori
O83218     4 ERIRVKLCGFDVELVDQSSRAIVHAVQKAGAEVLGPIPLPTRMHKFTVLRSPHVNKKSREQFEMRTHKRLIDIIEPSQEV 83  Treponema pallidum ...
P94266     5 DKIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSAL 84  Borrelia burgdorfer...
P48850     3 NKIKIRLKSFDHRSLDQATKEIVSAVKRTFATINGPIPLPRKIERFTVNRSPHVHKKSREQFEIRKHKRLLVIDDPNPAV 82  Rickettsia prowazek...
P47396     8 PELKIKLESYDSTLLDLTIKKIVEVVKGVNIKIKGPLPLPTKKEVITIIRSPHVDKASREQFEKNTHKRLMILVDVNQGG 87  Mycoplasma genitali...
AAF30639   3 QELRIRLESYDHRLLDDTVKTIVNISNSTGSKLRGPIPLPTKKEIFTILRSPHVNKSSREQFERRTHKRLIILENPQPKT 82  Ureaplasma parvum s...
CAA90780  41 lvadIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEV 120 baker's yeast
CAA18879  63 lcasLKIKSFETPKLDTFTDFICRTAYYMKIPIKGPRPLPNKVESWTLLRSPFIHKSSQENFERITHSRLIQLYSVNPVT 142 fission yeast
1P6G_J    84 VDA----LMRLDLAAGVDVQISL 102 Escherichia coli
O66430    84 IEA----LMEISLPAGVDVEVKM 102 Aquifex aeolicus VF5
P56017    82 VDS----LMKLDLAPEVDVEVTS 100 Helicobacter pylori
O83218    84 MNA----LMGLELSAGVDVRIKQ 102 Treponema pallidum subsp. pallidum str. Nichols
P94266    85 MDS----LMKLELPAGVEVDIKQ 103 Borrelia burgdorferi B31
P48850    83 VDA----LSKVDLAAGVDVVIEL 101 Rickettsia prowazekii str. Madrid E
P47396    88 IDS----LKKIKIPVGVTLRFSK 106 Mycoplasma genitalium G37
AAF30639  83 MEA----LKRLSVPFGVEVTFKI 101 Ureaplasma parvum serovar 3 str. ATCC 700970
CAA90780 121 LQM----LIA---------YITK 130 baker's yeast
CAA18879 143 LETffsyLRKCNM---WDLKLQA 162 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap