3J3V,1P85


Conserved Protein Domain Family
rplV_bact

?
TIGR01044: rplV_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L22, bacterial type
This model decribes bacterial and chloroplast ribosomal protein L22. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130116
View PSSM: TIGR01044
Aligned: 10 rows
Threshold Bit Score: 132.254
Threshold Setting Gi: 2500298
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J3V_S         5 AVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKR 84  Bacillus amylol...
O32986        11 AKARFVRVSPRKARRVIDLVRGRSVADALDILRWAPQAASEPVARVIASAAANAQNNNGLDPETLVVATVYAGEGPTAKR 90  Mycobacterium l...
P02423         5 AKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKR 84  Escherichia coli
P42060         5 AVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKR 84  Bacillus subtil...
CAA88014       5 AVARTVRIAPRKARLVMDLIRGKQVGEAVSNLNLTPISASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKR 84  Bacillus subtilis
P23311         5 AVARTVRIAPRKARLVIDLIRGKEVGERFAILRHTPKAASPIIEKVLKSAVANAEHNYDMDVNNLVISQAYVDEGPTLKR 84  Geobacillus ste...
P56047         4 ALLRFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVVASAVANG----SLDAKSALIVSCRVDAGPVLRR 79  Helicobacter py...
WP_003749277   5 AQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNGADIDELKVVTIFVDKGPSLKR 84  Neisseria
P95054        15 AKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKR 94  Mycobacterium t...
1P85_Q         5 AKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKR 84  Salmonella ente...
3J3V_S        85 FRPRAMGRASQINKRTSHITIVV 107 Bacillus amyloliquefaciens FZB42
O32986        91 IRPRAQGRAFRIRRRTSHITVVV 113 Mycobacterium leprae TN
P02423        85 IMPRAKGRADRILKRTSHITVVV 107 Escherichia coli
P42060        85 FRPRAMGRASQINKRTSHITIVV 107 Bacillus subtilis subsp. subtilis str. 168
CAA88014      85 LRPRAMGRASQINKRTSHITVVV 107 Bacillus subtilis
P23311        85 FRPRAMGRASAINKRTSHITIVV 107 Geobacillus stearothermophilus
P56047        80 SIPRAKGRATAIRKPTSHVFVEV 102 Helicobacter pylori 26695
WP_003749277  85 FQARAKGRGNRIEKQTCHINVTV 107 Neisseria
P95054        95 IRPRAQGRAFRIRRRTSHITVVV 117 Mycobacterium tuberculosis
1P85_Q        85 IMPRAKGRADRILKRTSHITVVV 107 Salmonella enterica subsp. enterica serovar Typhi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap