1VDZ


Conserved Protein Domain Family
ATP_syn_A_arch

?
TIGR01043: ATP_syn_A_arch 
Click on image for an interactive view with Cn3D
ATP synthase archaeal, A subunit
Archaeal ATP synthase shares extensive sequence similarity with eukaryotic and prokaryotic V-type (H+)-ATPases. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130115
View PSSM: TIGR01043
Aligned: 13 rows
Threshold Bit Score: 1088.22
Threshold Setting Gi: 114516
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VDZ_A         4 KGRIIRVTGPLVVADGMKgAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVRPGEPVVGTGASLSVELGPGLLTS 83  Pyrococcus hori...
AAC06375       4 KGEIYRVAGPVVTAIGLD-AKMYDLCKVGNEGLMGEVIQIVGDKTIIQVYEETGGVRPGEPCVTTGMSLAVELGPGLLSS 82  Methanosarcina ...
Q48332        12 DGVIASVSGPVVTARGLD-ARMNDVVYVGDEGLMGEVIEIEGDLTTIQVYEETSGVGPGEPVESTGEPLTVDLGPGMMDA 90  Haloferax volca...
P25163        10 TGEIESVSGPVVTATGLD-AQMNDVVYVGDEGLMGEVIEIEGDVTTIQVYEETSGIGPGQPVDNTGEPLTVDLGPGMLDS 88  Halobacterium s...
O29101         9 VGEIYRISGPLVVAEGLK-ARMYDLCKVGEEGLMGEVVGLVGQKVLIQVYEDTEGVKPGDKVENTGMPLSVELGPGLIRN 87  Archaeoglobus f...
O27036         4 EGRIIKIAGPVIIAEGMRgSQMYEMVKVGEDKLIGEIIELEGDTATIQVYEETAGIKPGETVERTGGPLSVELGPGILGS 83  Methanothermoba...
AAB64416       1 MGRIIRVTGPLVVADGMKgSKMYEVVRVGEMGLIGEIIRLEGDKAVIQVYEETAGIRPGEPVEGTGSSLSVELGPGLLTS 80  Desulfurococcus...
BAA23342       1 MGRIIRVTGPLVVADGMKgAKMYEVVRVGEMGLIGEIIRLEGDKAVIQVYEETAGIRPGEPVEGTGSSLSVELGPGLLTS 80  Thermococcus sp.
CAB57737       3 NGRIVRINGPLVVADNMRnAQMYEVVEVGEPRLIGEITRIEGDRAFIQVYEDTSGIKPNEPVYRTGAPLSIELGPGLIGK 82  Sulfolobus solf...
P09639         4 EGRVVRVNGPLVIADGMReAQMFEVVYVSDLKLVGEITRIEGDRAFIQVYESTDGVKPGDKVYRSGAPLSVELGPGLIGK 83  Sulfolobus acid...
Q57670         4 VGKIIKIAGPVVVAEGMKgAQMYEVVKVGEEKLTGEIIQLHDDKAVIQVYEETSGIKPGEPVVGTGAPLSVELGPGMLRA 83  Methanocaldococ...
P22662         4 KGEIYRVSGPVVTAIGLQ-AKMYDLVKVGNEGLMGEVIQILGPKTIIQVYEETAGIKPGEPCVSTGSSLSVELGPGLLSS 82  Methanosarcina ...
WP_010865716   4 KGSIVRISGPLVVAEGMSgAQMYEMVYVGEDRLIGEITRIRGDRAFIQVYESTSGLKPGEPVVGTGAPLSVELGPGLLGT 83  Aeropyrum pernix
1VDZ_A        84 IYDGIQRPLEVIREKTG-D-------FIARGVTAPALPRDKKWHFIPK-AKVGDKVVGGDIIGEVPETSIIVHKIMVPPG 154 Pyrococcus hori...
AAC06375      83 IYDGLQRPLHVLLERTG-G-------FIGRGVTADGLDHKKLWEFKPV-VKKGDGVIGGDVIGVVQETVNIEHKIMLPPD 153 Methanosarcina ...
Q48332        91 IYDGVQRPLDVLESKMDsA-------FLDRGVDAPGIDLDEKWEFEPT-VSEGDEVAPGDVVGTVPETVTIEHKVMVPPD 162 Haloferax volca...
P25163        89 IYDGVQRPLDVLEDEMG-A-------FLDRGVDAPGIDLDTDWEFEPT-VEAGDEVAAGDVVGTVDETVSIEHKVLVPPR 159 Halobacterium s...
O29101        88 IYDGVQRPLPVLKEVSG-D-------FIGRGIEAPGLDRKAKWEFKPL-VKKGEKVKPGEIIGTVQETEVVEQKILVPPN 158 Archaeoglobus f...
O27036        84 IFDGIQRPLENIKALTG-D-------YIERGVDVPSLPKDKKWTFKPT-AREGQMVKGGDIIGEVEETSSITHRIMIPPN 154 Methanothermoba...
AAB64416      81 MYDGIQRPLEKLRELSG-D-------FIARGLTAPALPRDKKWHFTPT-VKVGDKVTGGDILGVVPETSIIEHKILVPPW 151 Desulfurococcus...
BAA23342      81 MYDGIQRPLDVLRQLSG-D-------FIARGLTAPALPRDKKWHFTPK-VKVGDKVVGGDILGVVPETSIIEHKILVPPW 151 Thermococcus sp.
CAB57737      83 IFDGLQRPLDSIKELTKsP-------FIARGIKVPSIDRKTKWHFVPK-VKKGDKVEGGSIIGIVNETPLVEHRILVPPY 154 Sulfolobus solf...
P09639        84 IYDGLQRPLDSIAKVSNsP-------FVARGVSIPALDRQTKWHFVPK-VKSGDKVGPGDIIGVVQETDLIEHRILIPPN 155 Sulfolobus acid...
Q57670        84 MYDGIQRPLTAIEEKTG-Si------FIPRGVDVPALPRDIKWEFKPV-VNEGDYVEEGDIIGTVDETPSIVHKILVPIG 155 Methanocaldococ...
P22662        83 IYDGVQRPLHVLLEKMG-S-------FIQRGVSADGLDHKKLWDFKPI-VKKGDSVKGGDVIGVVQETVNIEHKIMVPPD 153 Methanosarcina ...
WP_010865716  84 IYDGVQRPLPIIAEKVA-EvdprrrmFVERGIQAPPLPRDRKFHFKPEpLKEGDKVEGGDALGRVPETSLIEHVVMVPPG 162 Aeropyrum pernix
1VDZ_A       155 IEG-EIVEIAeEGDYTIEEVIAKVKtpSGe-Ik-ELKMYQRWPVRVKRPYKEKLPPEVPLITGQRVIDTFFPQAKGGTAA 231 Pyrococcus hori...
AAC06375     154 ISG-TVSDIR-SGSFTVVDTICTLT--EG--P--ELQMMQRWPVRKPRPVKRKLTPEKPLVTGQRILDGLFPVAKGGTAA 225 Methanosarcina ...
Q48332       163 FGGgEVVAVE-EGEFSVTEAVVELD--SG--E--EITMHQEWPVRQARPAAEKKTPREPLVSGQRILDGLFPIAKGGTAA 235 Haloferax volca...
P25163       160 SDGgEVVAVE-SGTFTVDDTVVELD--TG--E--EIQMHQEWPVRRQRPTVDKQTPTEPLVSGQRILDGLFPIAKGGTAA 232 Halobacterium s...
O29101       159 VKEgVIAEIY-EGSFTVEDTIAVLE--DG--T--ELKLYHKWPVRIPRPYVEKLPPVVPLITGQRILDTFFPVAKGGTAA 231 Archaeoglobus f...
O27036       155 VEG-KLTMIApQGEYTVLDDIAEVEteSGt-E--KIQMLQKWPVRKGRPYKKKLDPDVPLVTGQRAQDTFFSVAKGGTAA 230 Methanothermoba...
AAB64416     152 VEG-EIVEIAeEGDYTVEEVIAKVKkpDGsiE--ELKMYHKWPVRVKRPYKNKLPPEVPLITGQRTIDTFFSIAKGGTAA 228 Desulfurococcus...
BAA23342     152 VEG-EIVEIAeEGDYTVEEVIVKVKkpDGtiE--ELKMYHRWPVRVKRPYKQKLPPEVPLITGQRTIDTFFSQAKGGTAA 228 Thermococcus sp.
CAB57737     155 VHG-TLKEVVaEGDYTVEDPIAIVDm-NGdeV--PVKLMQKWPVRIPRPFKEKLEPTEPLLTGTRVLDTIFPIAKGGTAA 230 Sulfolobus solf...
P09639       156 VHG-TLKELArEGDYTVEDVVAVVDm-NGdeI--PVKMYQKWPVRIPRPYKEKLEPVEPLLTGIRVLDTVFPIAKGGTAA 231 Sulfolobus acid...
Q57670       156 VKG-KIVEIK-EGKFTVEETVAVVEt-ENg-ErkEITMMQKWPVRKPRPYKEKLPPEIPLITGQRVEDTFFTLAKGGTAA 231 Methanocaldococ...
P22662       154 ISG-TISDIK-SGNFTVVDTICTLT--DG--T--ELQMMQRWPVRRPRPVKAKLTPTRPLVTGMRILDGLFPVAKGGTAA 225 Methanosarcina ...
WP_010865716 163 IRG-RLKWLAsEGDYSVEDTIAVVEr-DGrdV--EIRMHQRWPVRIPRPFKEKLEPQLPLITGVRIIDTFFPMAKGGTGA 238 Aeropyrum pernix
1VDZ_A       232 IPGPFGSGKTVTQHQLAKWSDAQVVIYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYT 311 Pyrococcus hori...
AAC06375     226 IPGPFGSGKTVTQQQLSKWSDTEIVVYIGCGERGNEMADVLWEFPELEEPQTGRPLMERTILVANTSNMPVAAREASVYT 305 Methanosarcina ...
Q48332       236 IPGPFGSGKTVTQHQLAKWADADIVVYVGCGERGNEMTEVIEDFPELDDPKTGNPLMARTCLIANTSNMPVAARESCIYT 315 Haloferax volca...
P25163       233 IPGPFGSGKTVTQQSLAKFADADIVVYIGCGERGNEMTEVIEDFPELPDPQTGNPLMARTTLIANTSNMPVAGRESCIYT 312 Halobacterium s...
O29101       232 IPGPFGSGKTVTQHQLAKWSDAQIVVYIGCGERGNEMTEVLEEFPELEDPRTGKPLMERTVLVANTSNMPVAAREASVYT 311 Archaeoglobus f...
O27036       231 IPGPFGSGKTVTQQQLAKWADADIIVYVGCGERGNEMTEVLKEFPELEDPKTGNPLMDRTVLIANTSNMPVAAREACVYT 310 Methanothermoba...
AAB64416     229 IPGPFGSGKTVTQHQLAKWSDAQVVVYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYT 308 Desulfurococcus...
BAA23342     229 IPGPFGSGKTVTQHQLAKWSDAQVVVYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYT 308 Thermococcus sp.
CAB57737     231 IPGPFGSGKTVTLQSLAKWSAAKIVIYVGCGERGNEMTDELRQFPSLKDPWTGRPLLERTILVANTSNMPVAAREASIYV 310 Sulfolobus solf...
P09639       232 IPGPFGSGKTVTLQSLAKWSAAKVVIYVGCGERGNEMTDELRSFPKLKDPWTGKPLLLRTILVANTSNMPVAARESSIYV 311 Sulfolobus acid...
Q57670       232 IPGPFGSGKTVTQHQLAKWSDADVVVYIGCGERGNEMTEVIEEFPHLEDIRTGNKLMDRTVLIANTSNMPVAAREASVYT 311 Methanocaldococ...
P22662       226 IPGPFGSGKTVTQQSLAKWSDTEIVVYIGCGERGNEMADVLSEFPELEDPQTGRPLMERTVLIANTSNMPVAAREASVYT 305 Methanosarcina ...
WP_010865716 239 VPGGFGTGKTVTLHSLAQWSEARVVIYIGCGERGNEMTEVLERFPQYKDPWTGKPLMDRTVLIANTSNMPVAAREASIYV 318 Aeropyrum pernix
1VDZ_A       312 GITIAEYFRDMGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLASKLAEFYERAGRVVTLGSDyrVGSVSVIGA 391 Pyrococcus hori...
AAC06375     306 GMTLAEYFRDMGYDVSLMADSTSRWPEAMREISSRLEEMPGEEGYPAYLSARLAEFYERAGVAETLCGE--KGSITAIGA 383 Methanosarcina ...
Q48332       316 GITIAEYYRDMGYDVALMADSTSRWAEAMREISSRLEEMPGEEGYPAYLAARLSEFYERAGYFTTVNGE--EGSVSVIGA 393 Haloferax volca...
P25163       313 GITIAEYYRDMGYDVALMADSTSRWAEAMREISSRLEEMPGEEGYPAYLAARLSEFYERAGYFENFNGT--EGSISVIGA 390 Halobacterium s...
O29101       312 GITIAEYFRDMGYDVAIQADSTSRWAEAMREISGRLEEMPGEEGYPAYLASRLAEFYERAGRVKTLAGN--IGSVTVVGA 389 Archaeoglobus f...
O27036       311 GITIAEYFRDMGYDVALMADSTSRWAEAMREISGRLEEMPGEEGYPAYLASRLAQFYERAGRVTTIGSEdkIASVSVVGA 390 Methanothermoba...
AAB64416     309 GITIAEYFRDQGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLASKIAEFYERAGRVVTLGSEprVGSVSVIGA 388 Desulfurococcus...
BAA23342     309 GITIAEYFRDQGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLASKIAEFYERAGRVITLGSDerVGSVSVIGA 388 Thermococcus sp.
CAB57737     311 GITMAEYFRDQGYDTLLVADSTSRWAEALRDLGGRMEEMPAEEGFPSYLPSRLAEYYERAGRVKTIGNPerFGSVTVASA 390 Sulfolobus solf...
P09639       312 GVTMAEYFRDQGYDVLLVADSTSRWAEALRDLGGRMEEMPAEEGFPSYLPSRLAEYYERAGRVIALGNPerYGSVTIASA 391 Sulfolobus acid...
Q57670       312 GITIAEYFRDMGYGVLLTADSTSRWAEAMREISGRLEEMPGEEGYPAYLASRLAQFYERAGRVITLGKDnrQGFVCIVGA 391 Methanocaldococ...
P22662       306 GITIAEYYRDMGLDVSLMADSTSRWAEAMREISSRLEEMPGEEGYPAYLSARLAEFYERAGVAESLCGE--TGSITVIGA 383 Methanosarcina ...
WP_010865716 319 GITIAEYYRDMGYDVLLVADSTSRWAEALREIAGRLEEMPAEEGYPSYLASRLAEFYERAGRVKALGSPerSGSVTVVGA 398 Aeropyrum pernix
1VDZ_A       392 VSPPGGDFSEPVVQNTLRVVKVFWALDADLARRRHFPAINWLTSYSLYVDAVKDWWHKNIDPEWKAMRDKAMALLQKESE 471 Pyrococcus hori...
AAC06375     384 VSPPGGDFSEPVTQNTLRIVKVFWALDAKLSQKRHFPAINWLNSYSLYKEDLNDWFTENVAPDYVPMRERAMDMLQTESE 463 Methanosarcina ...
Q48332       394 VSPPGGDFSEPVTQNTLRIVKTFWALDADLAERRHFPAINWNESYSLYQEQLDPWFVENVEDDWAEERQWAVDVLDEENE 473 Haloferax volca...
P25163       391 VSPPGGDFSEPVTQNTLRIVKTFWALDSDLAERRHFPAINWDESYSLYKDQLDPWFTDNVVDDWAEQRQSAVDILDEESE 470 Halobacterium s...
O29101       390 VSPPGGDFSEPVTQNTLRIVKVFWALDAKLAARRHFPAINWLQSYSLYVDTLKDWFAENVSEEWNELRRWAMEVLQEEAN 469 Archaeoglobus f...
O27036       391 VSPPGGDLSEPVTQNTLRICKVFWALDASLADKRHFPSIDWLQSYSLYIDSVQEWWASNVDPEWRKFRDEAMALLQKEAE 470 Methanothermoba...
AAB64416     389 VSPPGGDFSEPVVQNTLRVVKVFWALDADLARRRHFPAINWLRSYSLYLDSIQDWWHKNVDPEWRKMRDTAMALLQKEAE 468 Desulfurococcus...
BAA23342     389 VSPPGGDFSEPVVQNTLRVVKVFWALDADLARRRHFPAINWLRSYSLYVDAIQDWWHKNVDPEWRKMRDTAMALLQKEAE 468 Thermococcus sp.
CAB57737     391 VSPPGGDFTEPVTSQTLRFVKVFWPLDVSLAQARHYPAINWLQGFSAYVDLVANWWNTNVDPKWREMRDMMVRTLIREDE 470 Sulfolobus solf...
P09639       392 VSPPGGDFTEPVTSNTLRFVRVFWPLDVSLAQARHYPAINWIQGFSAYVDLVAQWWHKNVDPNWKEMRDTMMKVLIREDE 471 Sulfolobus acid...
Q57670       392 VSPPGGDFSEPVTSNTLRIVKVFWALDANLARRRHFPAINWLQSYSLYIDDVTEWWNTNTGPDWRQLRDEAMSLLQKEAE 471 Methanocaldococ...
P22662       384 VSPPGGDFSEPVTQNTLRIVKVFWALDAKLSQRRHFPAINWLNSYSLYKDSLNDWFADNVAPDYVPLRERAMEMLQTESE 463 Methanosarcina ...
WP_010865716 399 VSPPGGDFSEPVTSHTTRFIRVFWALDTKLAYSRHYPAINWLMSYSAYVDLVTQWWHENVDKRWREYRDEAMDILLRESE 478 Aeropyrum pernix
1VDZ_A       472 LQEIVRIVGPDALPERERAILLVARMLREDYLQQDAFDEVDTYCPPEKQVTMMRVLLNFYDKTMEAINRGVPLEEIAKLP 551 Pyrococcus hori...
AAC06375     464 LQEIVQLVGSDALPEEQQLLLEITRMIREIFLQQNAFHPIDTYSPFEKQYKIMKAIMKWGDAAMDALKSGVPSSEILKIE 543 Methanosarcina ...
Q48332       474 LQEIVQLVGKDALPEDQQLTLEIARYLREAYLQQNAFHPTDTYCSPEKTYGILTAIHAFNDEAFKALEAGVPVEEIQAIE 553 Haloferax volca...
P25163       471 LEEIVQLVGKDALPEDQQLTLEVARYIREAWLQQNALHDVDRYCPPEKTYAILSGIKTLHEESFEALDAGVPVEEITSID 550 Halobacterium s...
O29101       470 LQEIVQLVGSDALPESQRVLLEVARIIREVYLIQYAYHPVDTYCSVQKQYDMLKAIKQINDWFYQALEAGKTIDEIAGVE 549 Archaeoglobus f...
O27036       471 LQEIVQLVGPDALPDRERITLETTRMIREDFLQQNAYHEVDTYCSPSKQFEMLRTIIMFHRNATAALEKGAPAADIISLP 550 Methanothermoba...
AAB64416     469 LQEIVRIVGPDALPDREKAILIVTRMLREDYLQQDAFDEVDTYCPPKKQVTMMRVILNFYERTMEAVDRGVPVDEIAKLP 548 Desulfurococcus...
BAA23342     469 LQEIVRIVGPDALPDREKAILIVTRMLREDYLQQDAFDEVDTYCPPKKQVTMMRVILNFYEKTMQAVDRGVPVDEIAKLP 548 Thermococcus sp.
CAB57737     471 LRQIVRLVGPESLAEKDKLILETARLIKEAFLKQNAYDDIDAFSSPQKQARIMRLIYLFNTYASKLVERGIPTKKIVDSM 550 Sulfolobus solf...
P09639       472 LRQIVRLVGPEELAEKDKLVLEAAKLIKDAFLKENAYDDIDAFSSPQKQVRIMRLIYIFYNQSQDLISKGVPLKKILDKV 551 Sulfolobus acid...
Q57670       472 LQEIVQLVGPDALPDRERVILEVARMLREDFLQQDAFDEVDTYCPPMKQYLMLKIIMTFYQEALKAVERGVEPAKILGVS 551 Methanocaldococ...
P22662       464 LQEIVQLVGSDALPDDQQLLLEITRMLREIFLQQNAFHPVDAYSPFDQQYKILKAIMKWGDAAMDALKSGVPVTEIIKLE 543 Methanosarcina ...
WP_010865716 479 LQEIVRLVGTEGLDEKDKMVLETARLIKDGFLKQNAFDPIDAFATPQKQFRLLKMIMDIHRKSLELIEKGVTTQQILQAL 558 Aeropyrum pernix
1VDZ_A       552 --VREEIGRMKFERDvskIRSLIDKTNEQFEELFK 584 Pyrococcus horikoshii
AAC06375     544 --SKDSLPKVKYEEN---FEDSLNAVLAKMDKEFA 573 Methanosarcina mazei Go1
Q48332       554 --AAPRLNRIGVQED---WEAYIEDLKAEITEQLR 583 Haloferax volcanii DS2
P25163       551 --AAPRLNRLGTTPDd-eHEAEVAEIKQQITEQLR 582 Halobacterium salinarum
O29101       550 --GLEEFARAKFEED---YKPAMEAALEKIRKNLL 579 Archaeoglobus fulgidus DSM 4304
O27036       551 --VKEDIGRMKYIPEeefP-ARIKEIQERIVKECS 582 Methanothermobacter thermautotrophicus str. Delta H
AAB64416     549 --VREKIGRMKFEPDiekIRALIDETNEQFEELFK 581 Desulfurococcus sp. SY
BAA23342     549 --VREKIGRMKFEPDvekVRALIDETNQQFEELFK 581 Thermococcus sp.
CAB57737     551 gqLLPEIIRSKAAIKn-dELNRYDELERKLITVFE 584 Sulfolobus solfataricus P2
P09639       552 gpIEPEIIRIKYTIKn-dELNKIDEIENKLKATFD 585 Sulfolobus acidocaldarius
Q57670       552 --VKQDIARMKYIPHdefINVKSKEIMEKIKNELG 584 Methanocaldococcus jannaschii DSM 2661
P22662       544 --SKNVLAKVKYEEK---FDESMNAVLAQMDKEFA 573 Methanosarcina barkeri
WP_010865716 559 grLYIDIVKAKFTIPn-dQLEKIDEIRDRALKALD 592 Aeropyrum pernix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap