Conserved Protein Domain Family
pyrD_sub1_fam

?
TIGR01037: pyrD_sub1_fam 
dihydroorotate dehydrogenase (subfamily 1) family protein
This family includes subfamily 1 dihydroorotate dehydrogenases while excluding the closely related subfamily 2 (TIGR01036). This family also includes a number of uncharacterized proteins and a domain of dihydropyrimidine dehydrogenase. The uncharacterized proteins might all be dihydroorotate dehydrogenase.
Statistics
?
PSSM-Id: 130109
View PSSM: TIGR01037
Aligned: 6 rows
Threshold Bit Score: 484.239
Threshold Setting Gi: 3914509
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O66461   3 LSVELFGIRFKNPVWVASGTFGYGVEAAEIYDISKLGAVVTKGLSLKERLGNETPRIVETPCGMLNSIGLQNPGVEKFLK 82  Aquifex aeolicus VF5
P25996   2 LEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLSCLGAIMIKATTKEPRFGNPTPRVAETGAGMLNAIGLQNPGLDSVLH 81  Bacillus subtilis sub...
O27281   5 LETSICNIELRNPTILAAGVMGSMASSLNRIYRGGAGAVVTKSFSLRPNPGYRNPTTVEVTGGVINAIGLSNPGVEAFRE 84  Methanothermobacter t...
Q58070   6 LKTNICGIEFKNPVFLASGIMGETGSALKRIAKGGAGAVTTKSIGLNPNPGHKNPTIVEVYGGFLNAMGLPNPGVDEYLE 85  Methanocaldococcus ja...
O59185   6 LEVKLFGIRFENPLILASGVVDMTPELLRRAHNEGAGGVVTKSIGKEPRKGYDNPTIVELPYGLINAMGLPNPGWEAFLN 85  Pyrococcus horikoshii...
O29513   4 LETEIGGLRMKNPLMLASGIMGSKVHSLNLIARD-AGAVVTKSVGVEEREGYRNPTVVNWKCGLINAVGLASPAAKDFAE 82  Archaeoglobus fulgidu...
O66461  83 EIYPKIKDVDTH---FIANVFGETEEEYVEVCMALEDADK-IVAYELNVSCPNVKK-GGILFGHDPVILGNLVDRIKAKI 157 Aquifex aeolicus VF5
P25996  82 HELPWLEQFDTP---IIANVAGSQVDDYVEVAEHISKAPN-VHALELNISCPNVKT-GGIAFGTNPEMAADLTKAVKEVS 156 Bacillus subtilis sub...
O27281  85 ELKLVDEEVP-----LIASVYGASPEEFASAAASVE---EyADMIELNVSCPHAMAgCGASIGQDPELTFRVVSAVKDAV 156 Methanothermobacter t...
Q58070  86 EIEKVRDELNRMdvrIIGSIYGKDEEEFAEVAKKME---RyVDIIELNISCPHAKG-YGATIGQNPDLSYDVCKAVKKAV 161 Methanocaldococcus ja...
O59185  86 EFIDERFDFP-----VIVSIFGGTPEEFAFLAEKLE---PvADAFELNLSCPHAKG-YGMEIGQDPKNVYEVVKAVKDVT 156 Pyrococcus horikoshii...
O29513  83 ELKDYTNEAP-----LLISLYGHSVEEFSDLVDTFDSALPyLHGYELNLSCPHVKG-AGLDIGMDLELSAAIVEELKGKT 156 Archaeoglobus fulgidu...
O66461 158 KKPLLVKLSPNVTDVTEFAKVCIENGADGLVLINTLM-GMKINIWKRKPDLATKTGGLSGPAILPIAVRMIYQVYEKFGd 236 Aquifex aeolicus VF5
P25996 157 DVPVYVKLSPNVANITEIALAIEEAGADGLTMINTLI-GMRLDLKTGKPILANKTGGLSGPAVKPVAIRMVYEVSQMVN- 234 Bacillus subtilis sub...
O27281 157 DVPISTKLTPNVTDIVEIAGSAEEAGSDALTLINSLGpGMKIDIKTARPILSNAFGGMSGPAIKPVAVRCVYDVYRSVD- 235 Methanothermobacter t...
Q58070 162 KIPVFAKLTPNVTDIIEIAQAVVDAGVDGLVAINTVR-GMAIDIRAKKPILANKFGGLSGKAIKSIGIKVVWDLYENFD- 239 Methanocaldococcus ja...
O59185 157 DKPVIAKLTPNVNDITKLGLAAERGGADGVSAINTVK-AIAIDIYAKRPILSNKVGGYSGPGIKPIALRAVYDLAKVLD- 234 Pyrococcus horikoshii...
O29513 157 KNPVFAKLS-AMHDYLKLAKVLEDAGVDGITISNTLR-GMKIDIMSGKPVLSNLSGGVSGPAIKPIALKCVYDLYKEIE- 233 Archaeoglobus fulgidu...
O66461 237 rIPIIGVGGITTWEDAMEHVMAGASAVQVGTANFYEP-LAPLKVIEGIENFMKSQNIKDFKELIGIAH 303 Aquifex aeolicus VF5
P25996 235 -IPIIGMGGVQTAEDALEFLLAGASAVAVGTANFVNP-FACPEIIEQLPSVLLQYGYQSIEECIGRSW 300 Bacillus subtilis subsp. subtilis...
O27281 236 -IPIMGVGGVRDFQDAVEFLFAGARAVQVGTAIMYDGpEVFMKICRGLEAFMMAEGFSSVDEMVGLAH 302 Methanothermobacter thermautotrop...
Q58070 240 -VPIIGVGGIMSGEDAIEYMMAGASAVQIGSGVYYRGyDIFKKVCDEIISFLKEENLT-LEEIVGMAH 305 Methanocaldococcus jannaschii DSM...
O59185 235 -IPVIGIGGITSWRDAVEFLLAGASALQIGTAVYLRGfKVFKEISNGIIEYLKEEGFSSIRDIIGLAL 301 Pyrococcus horikoshii OT3
O29513 234 -VPIVGCGGITSFEDVLEFIMAGARAVQIGSAVYYSR-RIFYSLKESLIAFTRARDCT-ISDLIGIAH 298 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap