2J5V


Conserved Protein Domain Family
proB

?
TIGR01027: proB 
Click on image for an interactive view with Cn3D
glutamate 5-kinase
Bacterial ProB proteins hit the full length of this model, but the ProB-like domain of delta 1-pyrroline-5-carboxylate synthetase does not hit the C-terminal 100 residues of this model. The noise cutoff is set low enough to hit delta 1-pyrroline-5-carboxylate synthetase and other partial matches to this family. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 162163
View PSSM: TIGR01027
Aligned: 13 rows
Threshold Bit Score: 468.326
Threshold Setting Gi: 6225881
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2J5V_A   5 QTLVVKLGTSVLTGGSRR--LNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSR 82  Escherichia coli
P39820   4 QRIVVKIGSSSLTNSKGS--IDEAKIREHVQAISVLKKAGHEMILITSGAVAAGFSSLGYPSRPVTIKGKQAAAAVGQTL 81  Bacillus subtilis sub...
Q9JZG2   4 KRIVFKVGTSSITHSDGS--LSRGKIQTITCQLAALHHAGHELVLVSSGAVAAGFGALGFKKRPVKIADKQASAAVGQGL 81  Neisseria meningitidi...
O67209   1 MRIVFKIGSNLLETDEGD--IDLSFLSKLAEGIKKLHSFGDKVLIVSSGAVLSGAKKLGIKEKPKDLTLKQALASVGQSY 78  Aquifex aeolicus VF5
Q9WYD0   3 MKVVVKVGSNLLVGSSG---LRKSYIAELCREVARLKSQGHEISIITSGARAAGFTYLGKGKRTQDLHIKQALCAVGQVQ 79  Thermotoga maritima MSB8
P71910  13 RGLVVKVGTTALTTPSGm--FDAGRLAGLAEAVERRMKAGSDVVIVSSGAIAAGIEPLGLSRRPKDLATKQAAASVGQVA 90  Mycobacterium tubercu...
P46546   9 KRVVVKIGSSSLTNDEDGhtVDPNRINTIVNALQARMEAGSDLIVVSSGAVAAGMAPLGLSTRPTELAVKQAAAAVGQVH 88  Corynebacterium gluta...
Q9RTD8   1 MRVVLKLGTSVLTAGTDR--LHRPRLVDLMRDIAAVSAQGHEVVLVSSGAVTAGWEALGFPPRERTLAEKQLLAAVGQVQ 78  Deinococcus radiodura...
P43763   4 KTIVVKFGTSTLTQGSPK--LNSPHMMEIVRQIAQLHNDGFRIVIVTSGAIAAGRHYLNHPQLPPTIASKQLLAAVGQSQ 81  Haemophilus influenza...
P07005   5 QTLVVKLGTSVLTGGSRR--LNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSR 82  Escherichia coli
Q9ZG98  13 RRLVVKVGSAVLSGPQG-----RQHQLAIAAQVAALRAEGREVVLVSSGAQATGMQKLGLTEKPKSMPGKQALAAVGQPT 87  Meiothermus ruber
P73071   8 QTLVIKIGTSSLARPETGq-LALSTIAALVETVCKLIGQGHRVVLVSSGAIGVGCSRLGLTERPKKMALKQAIAAVGQGR 86  Synechocystis sp. PCC...
P38690   5 YTIVIKLGSSSLVDESTKe-PKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALNIPHKPKQLSEVQAIAAVGQGR 83  Saccharomyces cerevis...
2J5V_A  83 LIQLWEQLFSIYGIHVGQMLLTRADMEDRE--RFLNARDTLRALLDNNVVPVINENDAVATAEIKVGDNDNLSALAAILA 160 Escherichia coli
P39820  82 LMQQYMNQFKQYSLTPGQILLTRNDFSKRE--RYRNAYATIMELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLI 159 Bacillus subtilis sub...
Q9JZG2  82 LMEEYTANLSSDGIVSAQILLSRADFADKR--RYQNAGGALSVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMI 159 Neisseria meningitidi...
O67209  79 LMHLYDTIFSNYGLKVGQVLLTKDVFSKEKeeRFKNAKSTLEKLLELGVVPVINENDAVAVEELVFGDNDFLAVYVSFMV 158 Aquifex aeolicus VF5
Q9WYD0  80 LMKVYENAFDFYGIKIAQILLTRDTFSNRK--RYLNLRNTLIGLSEFDVVPIVNENDTVATEEITLGDNDTLAAMFSIAW 157 Thermotoga maritima MSB8
P71910  91 LVNSWSAAFARYGRTVGQVLLTAHDISMRV--QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLV 168 Mycobacterium tubercu...
P46546  89 LMHQWGRSFARYGRPIGQVLLTAADAGKRD--RARNAQRTIDKLRILGAVPIVNENDTVATTGVNFGDNDRLAAIVAHLV 166 Corynebacterium gluta...
Q9RTD8  79 LMHLYTSLAELYGLRSAQLLLTADDFRERT--RYLNARTTLEGCLSRGVLPVINENDTVAVEQIKVGDNDTLSAFVANLV 156 Deinococcus radiodura...
P43763  82 LIQAWEKLFAIYDIHIGQLLLTRADIEDRE--RFLNARDTLYALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILV 159 Haemophilus influenza...
P07005  83 LIQLWEQLFSIYGIHVGQMLLTRADMEDRE--RFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILA 160 Escherichia coli
Q9ZG98  88 LMLLWEQAFSWYDLKVAQVLLTAEDLAHRH--RYLNARQTLETLLEWGIVPIINENDTVMVEEIKFGDNDQLSALIASLV 165 Meiothermus ruber
P73071  87 LMRTYDDLFSSLRQPIAQILLTRRELIERT--AYVNAYNTFQALFELGVIAIVNENDTVAIDELKFGDNDTLSALVASLV 164 Synechocystis sp. PCC...
P38690  84 LIARWNMLFSQYGEQTAQILLTRNDILRWN--QYNNARNTINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALV 161 Saccharomyces cerevis...
2J5V_A 161 GADKLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSv--SG-LGTGGMSTKLQAADVACRAGIDTIIAAGS 237 Escherichia coli
P39820 160 HADQLMILTDINGLYDANPNENPEAKRFDYLPEITPELLGYAGSA---GSkVGTGGMKSKLLATQTALSLGVKVFIGTGS 236 Bacillus subtilis sub...
Q9JZG2 160 QADLLVLLTDIDGLYTGNPNSNPDAVRLDKIEHINHEIIEMAGGS---GSaNGTGGMLTKIKAATIAAESGVPVYICSSL 236 Neisseria meningitidi...
O67209 159 NADLLVIFSSAGGLKDDKD------RIIPVVEDIEKVFKYVRGTg---TS-FGTGGMRSKLEATRLATTLNIPVIITSKE 228 Aquifex aeolicus VF5
Q9WYD0 158 DADFLVLFTTVDGVIDENG------KLVERFDESVKLKDMGK------SS-WGTGGIRSKIESALMASRCGVKATICSGN 224 Thermotoga maritima MSB8
P71910 169 GADALVLLSDIDGLYDCDPRKTADATFIPEVSGPADLDGVVAGRSs--H--LGTGGMASKVAAALLAADAGVPVLLAPAA 244 Mycobacterium tubercu...
P46546 167 SADALVLLSDVDGLFDKNP-TDPTAKFISEVRDGNDLKGVIAGDGg--K--VGTGGMASKVSAARLASRSGVPVLLTSAA 241 Corynebacterium gluta...
Q9RTD8 157 EADLLLILTDAPGLYTADPRTHPDATLIPVVERVTPDIWALAGGAg--SH-RGTGGMHTKIQAAEIATRAGTPVVIAPGD 233 Deinococcus radiodura...
P43763 160 QAEQLYLLTDQQGLFDSDPRKNPEAKLIPVVEQITDHIRSIAGGSg--TN-LGTGGMMTKIIAADVATRSGIETIIAPGN 236 Haemophilus influenza...
P07005 161 GADKLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSv--SG-LGTGGMSTKLQAADVACRAGIDTIIAAGS 237 Escherichia coli
Q9ZG98 166 GADLLILLSDIEALYEADPRTHPEAQPIPYVERVDAGVLRMAGDSp--NR-VGTGGMKSKLLAAEKAQAAGIPHLLLPGT 242 Meiothermus ruber
P73071 165 EADWLFLLTDVDRLYSSDPRLDPDAYPIPLVKAAELAQLQVRTDSt-gSA-WGTGGMATKITAARIATGSGVRTVITHGQ 242 Synechocystis sp. PCC...
P38690 162 GADFLFLLTDVDCLYTDNPRTNPDARPIVLVPELSEGLPGVNTSSgsgSE-VGTGGMRTKLIAADLASNAGIETIVMKSD 240 Saccharomyces cerevis...
2J5V_A 238 KP---GVIGDVME-------------------------------GISVGTLFHAQ-ATP-LENRKRWI-FGAPPAGEITV 280 Escherichia coli
P39820 237 GE---QKLADILD-------------------------------GRGDGTYIGDKeLSS-VNNTRQWIqFHSPISGEIII 281 Bacillus subtilis sub...
Q9JZG2 237 KP---DALAEAAE-------------------------------HQADGSFFVPR-AKG-LRTQKQWLaFYSESRGSVYV 280 Neisseria meningitidi...
O67209 229 -----ENILDLRN-------------------------------LKTKGTLFKPS-KRK-LRNALKVIaTLEEPKGIIVV 270 Aquifex aeolicus VF5
Q9WYD0 225 DV---SNLTRFVK-------------------------------GEPVGTVFEPQ-GR--LKAKKAWIaFLSEPAGKIYV 267 Thermotoga maritima MSB8
P71910 245 D------AATALA-------------------------------DASVGTVFAAR-PAR-LSARRFWVrYAAEATGALTL 285 Mycobacterium tubercu...
P46546 242 N------IGPALE-------------------------------DAQVGTVFHPK-DNR-LSAWKFWAlYAADTAGKIRL 282 Corynebacterium gluta...
Q9RTD8 234 LP---EALRRVVD-------------------------------GEALGTRFLAH-GTR-LEARKRWIlAEIAH-GRLLL 276 Deinococcus radiodura...
P43763 237 RP---NVIADLAY-------------------------------EQNIGTKFIAH-QSDrLESRKQWLfAAPSA-GIITI 280 Haemophilus influenza...
P07005 238 KP---GVIGDVME-------------------------------GISVGTLFHAQ-ATP-LENRKRWIfGAPPA-GEITV 280 Escherichia coli
Q9ZG98 243 RP---QSIAEALQ-------------------------------GAPVGTLFAGG-QRR-YSGRKLWLyQLPKPQGEVVV 286 Meiothermus ruber
P73071 243 KP---EQILAILQ-------------------------------GANLGTQFEAQpRSDnARKR--WIaYGLVPTGKIFI 286 Synechocystis sp. PCC...
P38690 241 RPeyvPKIVDYIQhhfrpprhigngtqqqfldlqdteleqlrryDVPMHTKFLANdNKHkLKNREFWIlHGLITKGAIII 320 Saccharomyces cerevis...
2J5V_A 281 DEGATAAILERGSS-LLPKGIKSVTGNFSRGEVIRICN----Le--------GRDIAHGVSRYNSDALRRIAGHHsqeiD 347 Escherichia coli
P39820 282 DAGAEEAMIHNGSS-LLPAGVVGVNGSFPKGAVVEVRG----P---------GGVIGKGQTHYSSEEIMEAKGKR----S 343 Bacillus subtilis sub...
Q9JZG2 281 DEGAEHALSEQGKS-LLMSGIAGIEGHFSRMDTVTVYS----Ka-------tKQPLGKGRVLFGSAAAEDLLKSRk--aK 346 Neisseria meningitidi...
O67209 271 DRGAQEALKA-GKS-LLPAGVVSVQGNFKRGDVVSIQN----Ee--------gLIIGKGKVNFSSEEIEKIKGLKtsevR 336 Aquifex aeolicus VF5
Q9WYD0 268 NKGAEEALKS-GNS-LLPVGVTGVEGTFDVGDVVEIVN----Ee--------gELVGRGIVNYSSSDLEKIAGHKssdlK 333 Thermotoga maritima MSB8
P71910 286 DAGAVRAVVRQRRS-LLAAGITAVSGRFCGGDVVELRA----Pd--------aAMVARGVVAYDASELATMVGRStselP 352 Mycobacterium tubercu...
P46546 283 DDGAVEAVTSGGKS-LLAVGITEIIGDFQQGEIVEILG----Pa--------gQIIGRGEVSYDSDTLQSMVGMQtqdlP 349 Corynebacterium gluta...
Q9RTD8 277 DGGAAQAVRERGSS-LLPAGIRQVEGDFERGHTVRLLA----Pd--------gQELGRGLTRYRADDLRRVCGHHsreiE 343 Deinococcus radiodura...
P43763 281 DNGAQNAILEQNKS-LLPAGIINVEGRFSRGEVVKIRT----Qs--------gKDIALGMPRYNSDALQLIKGRKsadiE 347 Haemophilus influenza...
P07005 281 DEGATAAILERGSS-LLPKGIKSVTGNFSRGEVIRICN----Le--------gRDIAHGVSRYNSDALRRIAGHHsqeiD 347 Escherichia coli
Q9ZG98 287 DAGAAKALRQGGAS-LLPAGILEVRGQFGVGEAVRCLD----Eq--------gNLIGVGLVNYSAAELARIKRRKtreiE 353 Meiothermus ruber
P73071 287 DAGAVQALKARGKS-LLAIGVVALEGEFSATDAVIICD----Pq--------gQELGRGLVNYNCNELEKIKGLHseaiA 353 Synechocystis sp. PCC...
P38690 321 DENSYDKLLSKDMAsLTPNAVIEVRDNFHELECVDLKIgqrlPngeldiskpIQSVGCVRSNYTSLELAKIKGLPsekiH 400 Saccharomyces cerevis...
2J5V_A 348 AILGYEYGPVAVHRDDMIT 366 Escherichia coli
P39820 344 DELDFEKTFEVIHRNDWVN 362 Bacillus subtilis subsp. subtilis str. 168
Q9JZG2 347 GVFIHRDDWISITPEIRLL 365 Neisseria meningitidis MC58
O67209 337 KLLNTT-KDEVIHRDNMVI 354 Aquifex aeolicus VF5
Q9WYD0 334 KILGYEGNKVVVHIDNMWV 352 Thermotoga maritima MSB8
P71910 353 GEL----RRPVVHADDLVA 367 Mycobacterium tuberculosis
P46546 350 DGM----QRPVVHADYLSN 364 Corynebacterium glutamicum
Q9RTD8 344 ALLGYTYGEEAVHRDDLVL 362 Deinococcus radiodurans R1
P43763 348 NVLGYEYGAVAMHRDDMII 366 Haemophilus influenzae Rd KW20
P07005 348 AILGYEYGPVAVHRDDMIT 366 Escherichia coli
Q9ZG98 354 ALLGYKNTDEAIHRDYFAL 372 Meiothermus ruber
P73071 354 AVLGYVGPDTVIHRDNLVL 372 Synechocystis sp. PCC 6803 substr. Kazusa
P38690 401 DVLGYSVSEYVAHRENIAF 419 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap