1VS6,3J3V


Conserved Protein Domain Family
rplS_bact

?
TIGR01024: rplS_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L19, bacterial type
This model describes bacterial ribosomoal protein L19 and its chloroplast equivalent. Putative mitochondrial L19 are found in several species (but not Saccharomyces cerevisiae) and score between trusted and noise cutoffs. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130096
View PSSM: TIGR01024
Aligned: 15 rows
Threshold Bit Score: 148.227
Threshold Setting Gi: 7674206
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VS6_P         2 SNIIKQLEQE-----QMKQDVPSFRPGDTVEVKVWVVE------GSKK---RLQAFEGVVIAIRNRGLHSAFTVRKI-SN 66  Escherichia coli
Q9X1Q7         2 DHLVKIIEKKy----E-KKEIPDFRPGDTVRVHVKVIE------GDRE---RTQVFEGIVIAKRGSGINKTFTVRRIgSH 67  Thermotoga mari...
O51642         1 MDLIRKIEAQn----K-KNEAFVFNVGDTVRVVYKIIE------GSNE---RLQSFEGIVISFQNKGIGKTFLIRKI-SS 65  Borrelia burgdo...
O83879         3 CHLIQQIENQq----R-KEPAETFRVGDTVRVHFKIVE------GKTE---RIQAYEGLVLCFKNSGVRRTFTVRKN-SY 67  Treponema palli...
P36239         6 QAIINSIEAE-----FLKEDLPTIHVGDTIKVGVKIVE------GGKE---RIQPYEGTVIAKRNGGISETITVRKI-FQ 70  Synechocystis s...
Q9ZK67         3 NRYIQQFEDAq----LKDKSMPTFKAGDTLRLGITIKE------GEKT---RTQYFEGVCIAIRGNGVDKTFCVRKIgAN 69  Helicobacter py...
P47682         7 QALIDAVEQK-----QLKEYVPEFGAGDEVNVAIKLRE-------KEKv--RVQNFTGTVLRRRGRGISETFMVRKT-TD 71  Mycoplasma geni...
O84031         2 GNLIKELQDE-----QCRTDLADFCVGDTIRVATNISE------GGKE---RVQVFQGTVMARKGGGAGETVSLHRV-AY 66  Chlamydia trach...
Q9ZE36         1 MNIIDNFEQEniaklTANKKIPDFEAGDTVKVTVKIIDkaiekdGKEKlteRFQAYEGVVIAKRNRGITSSFLVRKI-SH 79  Rickettsia prow...
WP_005648735   2 SNIIKQLEQE-----QLKQNVPSFRPGDTLEVKVWVVE------GSKR---RLQAFEGVVIAIRNRGLHSAFTLRKV-SN 66  Haemophilus
1VS6_P        67 GEGVERVFQTHSPVVDSISVKRRGAVRKAKLYYLRERTGK-AARIKERL 114 Escherichia coli
Q9X1Q7        68 GVGVERIFPVHSPVVEKIEVVRKGKVRRAKLYYLRNVRGK--IRIKERR 114 Thermotoga maritima MSB8
O51642        66 GIGVEKIFPVYSPIIEKVEVLRRGKVRRAKLYYMRNRIGKaAMKIKERL 114 Borrelia burgdorferi B31
O83879        68 GVGVERIFPLHSPRIERVDVVRAGKVRRAKLYYIREKIGKaAR-IKARI 115 Treponema pallidum subsp. pallidum str. Nichols
P36239        71 GVGVERVFLLHSPRVASIKVLRRGKVRRAKLYYLRDRVGK-ATRIKQRF 118 Synechocystis sp. PCC 6803 substr. Kazusa
Q9ZK67        70 NIGVEKIFPFYSESLASVEVLRVGRVRRAKLYYLRDRRGK-AARIKEVR 117 Helicobacter pylori J99
P47682        72 GIPIEKNFQIHNPNID-IEVKRRGKVRRAYISYMRERSGK-SAKIKEKK 118 Mycoplasma genitalium G37
O84031        67 GEGMEKSFLLNSPKIVSIEVVKRGKVSRARLFYLRGKTGK-AAKVKELI 114 Chlamydia trachomatis D/UW-3/CX
Q9ZE36        80 GEGVERRFMTYSPIVHSIDVVKYGVVRRAKLYYLRHRNGK-AARIREKL 127 Rickettsia prowazekii str. Madrid E
WP_005648735  67 GVGVERVFQTHSPAVDSIAVKRKGAVRKAKLYYLRERSGK-SARIKERL 114 Haemophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap