1P6G


Conserved Protein Domain Family
rpsE_bact

?
TIGR01021: rpsE_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S5, bacterial/organelle type
This model finds chloroplast ribosomal protein S5 as well as bacterial ribosomal protein S5. A candidate mitochondrial form (Saccharomyces cerevisiae YBR251W and its homolog) differs substantially and is not included in this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130093
View PSSM: TIGR01021
Aligned: 14 rows
Threshold Bit Score: 195.597
Threshold Setting Gi: 3914872
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P6G_E   9 ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNG-TLQHPVKGV 87  Escherichia coli
P44374  10 ELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEG-TLQHPVKGV 88  Haemophilus influenza...
O67563  27 QLEERLIYANRTARVTKGGRRFSFSTLVVVGDRKGHVGFGHGKAKEVTLAIAKGIEKAKKNVIRVPIVDG-TVPHDVIGT 105 Aquifex aeolicus VF5
P47414  57 EFEERIVKLKRISKTTKGGRNMRFSVLVVVGNKKGKVGYGIAKALEVPLAIKKAIKKAHNSIHTVEIHKG-SIYHEVIGR 135 Mycoplasma genitalium...
Q50301  65 EFEERIVKLKRISKTTKGGRNMRFSVLVVVGNRKGKIGYGIAKALEVPNAIKKAIKAAHNSLHTIEIHKG-SIYHEVIGR 143 Mycoplasma pneumoniae...
O51448   9 KQIEKLISLNRVTKVVKGGRRFSFAAFMVVGDGEGHVGWGFGKANDASDAIKKSLTSARKNLRFVPIRKG-TLPHEVIGC 87  Borrelia burgdorferi B31
Q9Z7S3  12 QLEEKVLVVNRCSKVVKGGRKFSFSALILVGDGKGRLGYGFAKANELTDAIRKGGEAAKKNLMKIEALEDgSIPHEVLVH 91  Chlamydia pneumoniae
P28543  12 QLEEKVLVVNRCCKVVKGGRKFSFSALILVGDRKGRLGFGFAKANELTDAIRKGGDAARKNLVSINSLEGgSIPHEVLVN 91  Chlamydia trachomatis
P73304  16 NWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNETGQVGVGVGKAGDVIGAVRKGVADGKKQLIEVPLTKSnSITHITNGV 95  Synechocystis sp. PCC...
O46910  16 DWQERVIQVRRVTKVVKGGKKLSFRAIIILGNERGQVGVGVGKASDVIGAVKKAVTDGRKNLINIPLTNQnSIPHIVQGY 95  Guillardia theta
1P6G_E  88 HTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEE 162 Escherichia coli
P44374  89 HTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDE 163 Haemophilus influenzae Rd ...
O67563 106 FGATKIIVLPARRGTGVVAGGAAKPVFELAGYTDVLTKIIGSTNPDNVVRAVFDALLQLKTPEQIAEERGLPVEE 180 Aquifex aeolicus VF5
P47414 136 KGASKVLLKPAPLGTGIIAGGAIRAIVELAGFSDIYTKNLGRNTPINMIHATMDGILKQLSPKKVALLRNKPISD 210 Mycoplasma genitalium G37
Q50301 144 SGASRVLLKPAPQGTGIIAGGAIRAIIELAGYSDIYTKNLGRNTPINMIHATMDGILKQLSPRRVAILRNKNLNE 218 Mycoplasma pneumoniae M129
O51448  88 FKKAKVLIKPATHGTGVIAGGPVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLNAEKVAEMRGKTLKT 162 Borrelia burgdorferi B31
Q9Z7S3  92 HDGAQLLLKPAKPGTGIVAGSRIRLILEMAGIKDIVAKSFGSNNPMNQVKAAFKALTGLSPRKDLLR-RGAAIND 165 Chlamydia pneumoniae
P28543  92 HDGAELLLKPAKPGTGIVAGSRIRLILEMAGVKDIVAKSLGSNNPMNQVKAAFKALLTLSCKDDIMK-RRAVIND 165 Chlamydia trachomatis
P73304  96 SGGAKVVVRPAAPGTGVIAGGAVRTVLELAGVKNILAKQLGSNNPLNNARAAINALETLRTFSEVAEERGVSVEH 170 Synechocystis sp. PCC 6803...
O46910  96 SGAAKVIIKPSAPGSGVIAGGSVRTILELAGIKNILAKQLGSSNPLNNARAAANALINLRTYTSVLNDRNLDLH- 169 Guillardia theta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap