
Conserved Protein Domain Family

TIGR01019: sucCoAalpha 
Click on image for an interactive view with Cn3D
succinyl-CoA synthetase, alpha subunit
This model describes succinyl-CoA synthetase alpha subunits but does not discriminate between GTP-specific and ATP-specific reactions. The model is designated as subfamily rather than equivalog for that reason. ATP citrate lyases appear to form an outgroup. [Energy metabolism, TCA cycle]
PSSM-Id: 130091
Aligned: 10 rows
Threshold Bit Score: 459.575
Threshold Setting Gi: 2829505
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O26663       233 FAFISGATAPPGKRMGHAGAIIEGGTGTASSKREALEAAGAVVVDRPSAIVDEIRAQL 290 Methanothermobacter thermautotrophicu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap