2YV1


Conserved Protein Domain Family
sucCoAalpha

?
TIGR01019: sucCoAalpha 
Click on image for an interactive view with Cn3D
succinyl-CoA synthetase, alpha subunit
This model describes succinyl-CoA synthetase alpha subunits but does not discriminate between GTP-specific and ATP-specific reactions. The model is designated as subfamily rather than equivalog for that reason. ATP citrate lyases appear to form an outgroup. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130091
View PSSM: TIGR01019
Aligned: 10 rows
Threshold Bit Score: 459.575
Threshold Setting Gi: 2829505
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YV1_A         8 ILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHG---------VPVFDTVKEAVKETDANASVIFV 78  Methanocaldococ...
P45102         3 ILIDKNTKVICQGFTGGQGTFHSEQALAYGTQLVGGVSPNKGGTTHLG---------LPVFNTVREAVENTGVTATVIYV 73  Haemophilus inf...
O26663         7 ILLDEDTRCLVQGITGKQGSFHTRQMLEYGTRIVAGVTPGKGGQEFLG---------VDVYNSVEEVTEEMDVNASIIFV 77  Methanothermoba...
Q58643         8 ILLDENTKAIVQGITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHG---------VPVFDTVKEAVKETDANASVIFV 78  Methanocaldococ...
O28098         3 IIVDERTKVVVQGITGYQGKFHTERMLNYGTKIVAGVTPGKGGTEVLG---------VPVYDSVKEAVREADANASVIFV 73  Archaeoglobus f...
P71558         6 IFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHedkggrlikLPVFGSVAEAMEKTGADVSIIFV 85  Mycobacterium t...
WP_009872208   3 ELLSKDLPIITQGITGKAGSFHTTQCVAYGSNFVGGVTPGKGGSQFLD---------LPIFDSVLEAKQATGCRASMIFV 73  Chlamydia trach...
WP_003238566   3 VFINKDTRVIVQGITGSTALFHTKQMLEYGTNIVGGVTPGKGGTEAEG---------VPVFNTVAEAVQTTGANASVIYV 73  Bacillales
WP_010883607   3 HSLSKNTPIITQGITGKAGSFHTEQCLAYGTNFVGGVTPGKGGTLWLD---------LPVYDSVLEAKQATGCRATMIFV 73  Chlamydia pneum...
O08371         3 ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLN---------LPVYNTVHEAKAKTGANASVIYV 73  Rickettsia prow...
2YV1_A        79 PAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDV--GVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMV 156 Methanocaldococ...
P45102        74 PASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNET--GVVMIGPNCPGVITPDECKIGIMPAHIHKKGKVGIV 151 Haemophilus inf...
O26663        78 PAPFAKDAAFESIKH-LDLVVIITEHIPVHDSMQIMEYASRM--GKTVIGPNTPGIITPGIGKLGIMPTHIFTEGTIGIV 154 Methanothermoba...
Q58643        79 PAPFAKDAVFEAIDAGIELIVVITEHIPVHDTMEFVNYAEDV--GVKIIGPNTPGIASPKVGKLGIIPMEVLKEGSVGMV 156 Methanocaldococ...
O28098        74 PAPFAADAVMEAADAGIKVIVCITEGIPVHDELKMYWRVKEA--GATLIGPNCPGIISPGKTHLGIMPVQIFKPGNVGIV 151 Archaeoglobus f...
P71558        86 PPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYAWAYNLEAghKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLV 165 Mycobacterium t...
WP_009872208  74 PPPFAAEAIFEAEDAGIELIVCITEGIPIKDMLEVASLMEKS--ASSLIGPNCPGVIKPGVCKIGIMPGYIHLPGKVGVV 151 Chlamydia trach...
WP_003238566  74 PAPFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRFMEGK--KTRLIGPNCPGVITPEECKIGIMPGYIHKKGHVGVV 151 Bacillales
WP_010883607  74 PPPYAAEAILEAEEAGIELIVCITEGIPVRDMLEVARVMDNS--TSQLIGPNCPGIIKPGECKIGIMPGYIHLPGNIGVV 151 Chlamydia pneum...
O08371        74 PPGFAADSILEAIDAKIEVVVCITEGIPVLDMIKVKRALIGS--KTRLIGPNCPGVITPGECKIGIMPGHIHKIGDIGIV 151 Rickettsia prow...
2YV1_A       157 SRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEK--MKKPV 234 Methanocaldococ...
P45102       152 SRSGTLTYEAVKQTTDEGFGQSTCVGIGGDPIPGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDn-VTKPV 230 Haemophilus inf...
O26663       155 SRSGTLTYEFAAQLTEAGFGQSTCVGIGGDPVTGLGFVDVLERFEDDPGTDAVVLIGEIGGDAEERAASYIEQ--MSKPV 232 Methanothermoba...
Q58643       157 SRSGTLTYEIAHQIKKAGFGVSTCVGIGGDPIVGLRYKEVLDLFEKDDETEAIVMIGEIGGGAEEEAAKFIEK--MKKPV 234 Methanocaldococ...
O28098       152 SRSGTLTYQIAYNLTKLGLGQSTVVGIGGDRIIGTDFVEVLRLFEDDKETKAVVLVGEIGGRDEEVAAEFIRE--MSKPV 229 Archaeoglobus f...
P71558       166 SKSGTLTYQMMFELRDLGF--STAIGIGGDPVIGTTHIDAIEAFERDPDTKLIVMIGEIGGDAEERAADFIKTn-VSKPV 242 Mycobacterium t...
WP_009872208 152 SRSGTLTYEAVWQLTQRKIGQSVCIGIGGDPLNGTSFIDALQEFEKDSQTEAVLMIGEIGGSAEEEAADWTRQh-SSKPV 230 Chlamydia trach...
WP_003238566 152 SRSGTLTYEAVHQLSEAGVGQSTAVGIGGDPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKAn-MTKPV 230 Bacillales
WP_010883607 152 SRSGTLTYEAVWQLTQLKIGQSICVGIGGDPLNGTSFIDVLQALEEDPYTELILMIGEIGGSAEEEAAAWIQAh-CTKPV 230 Chlamydia pneum...
O08371       152 SRSGTLTYEAVAQTTAAGLGQSTCVGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGSAEEDAADFIKQskIKKPI 231 Rickettsia prow...
2YV1_A       235 IGYIAGQSAPEGKRMGHAGAIVEKGKGTAESKMKALEEAGAYVAKNISDIPKLLAGIL 292 Methanocaldococcus jannaschii DSM 2661
P45102       231 VAYIAGITAPKGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLL 288 Haemophilus influenzae Rd KW20
O26663       233 FAFISGATAPPGKRMGHAGAIIEGGTGTASSKREALEAAGAVVVDRPSAIVDEIRAQL 290 Methanothermobacter thermautotrophicu...
Q58643       235 IGYIAGQSAPEGKRMGHAGAIVEKGKGTAESKMKALEEAGAYVAKNISDIPKLLAGIL 292 Methanocaldococcus jannaschii DSM 2661
O28098       230 VGYVAGLTAPPGKRMGHAGAIIEGGVGTAESKIKALEAAGARVGKTPMEVAELVAEIL 287 Archaeoglobus fulgidus DSM 4304
P71558       243 VGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREIL 300 Mycobacterium tuberculosis
WP_009872208 231 IAFIAGATAPKGKRMGHAGAIISGKSGDAFSKQEALRQAGVTVVESLALIGEAVASVL 288 Chlamydia trachomatis
WP_003238566 231 VGFIGGKTAPPGKRMGHAGAIISGGKGTADEKIKTLNACGIEVAETPSVMGETLIKVL 288 Bacillales
WP_010883607 231 VAFIAGVTAPKGKRMGHAGAIISGNSGDAKSKIQVLRESGVTVVESPAHIGKTVDAVL 288 Chlamydia pneumoniae
O08371       232 VSFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVIITRSPADIGKTMLDLL 289 Rickettsia prowazekii str. Madrid E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap