Conserved Protein Domain Family
2a58

?
TIGR01013: 2a58 
Phosphate:Na+ Symporter (PNaS) Family
[Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 162157
View PSSM: TIGR01013
Aligned: 7 rows
Threshold Bit Score: 227.436
Threshold Setting Gi: 238054342
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA57345     104 LVFLYFFVCSLDVLSSAFQLVGGKVAGKFFNNNSIMSNPLAGMVIGVLVTVLVQSSSTSTSIVVSMVASSLLPVHAAIPI 183 cattle
AAB16821      80 LGLLYFFICSLDVLSSAFQLVGGKAAGDIFKDNAVLANPVAGLVIGVLVTVMVQSSSTSSSIVVSMVSSGLLDVQSAVPI 159 winter flounder
Q28620       111 VTFLYLFVCSLDVLSSAFQLAGGKVAGDIFKDNAILANPVAGLVVGILVTVLVQSSSTATSIIVSMVSSGLLEVSSAIPI 190 rabbit
P54463         8 TALILFFLAGMNMLRKGLISMAYSKIEERL--LLFTDHPLKAFLISIVFTGILQSSSAFMVIVIGFVSAGVLSFKRTIPM 85  Bacillus subtil...
P32683        67 LVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDLSWLSPLLIFIGVIFFLGRKQSRAGQLGRVGIGLGLILLALEL 146 Escherichia coli
BAA87743      47 MVSSFVERELIKPRMAQVVLLGANVGTAVTAWIVATGIEWVSPALLFVGIILYRGGSTSRQG-AGTALLGIALMLLSLHL 125 Agrobacterium t...
XP_002644362  67 LIVLFIYVCSLANMSTAFGLLGSRGLGKAIQESPLINDPISAVIVGMLATVVLQSATTTTNILVTMVAANMITVHDAIPV 146 Caenorhabditis ...
CAA57345     184 IMGANIGTSITNTIVALMQAGDRKEFRRAFAGATVHDFFNWLSVLVLLPLEAATGYLERLTNLVVESFHFKNGEEAPELL 263 cattle
AAB16821     160 IMGANIGTSVTNTIVAMMQAGDRNEFRRAFAGATVHDFFNWLAVLILLPLEVATGVLYKLTHLIIESFNIQGGEDAPDLL 239 winter flounder
Q28620       191 IMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHVTGLVVASFNIRGGRDAPDLL 270 rabbit
P54463        86 ILGTNVGSTFTTEFIAIKMD----------IVIWVLLIGG---LLFFLTGRYPLKQLGTSFLGLGIIFFCISG------F 146 Bacillus subtil...
P32683       147 IVQAVTPITQANGVQVIFASLTGDILLDALIGAMFAIISYSSLAAVLLTATLTAAGIISFPVALCLVIGANLGSGLLAML 226 Escherichia coli
BAA87743     126 LSNATEPLRHSPALAAFIGLLENAWPVAMIFSAAIAFASSSSLAAVVLILSLTSTGILSGGLVVALVLGANFGGAIPPVI 205 Agrobacterium t...
XP_002644362 147 MIGSELGSSLVNAMVSLAYSGKPEQFRRAFSAAILGDVFNICGLFVIFPMEMVTGLIEKVSWWIVDPLISEQG-LSFKTL 225 Caenorhabditis ...
CAA57345     264 KVITDPFTKLIIQLDKSILNQIAmndeSVQNKSMIKIWCKTFTnvternvtvpspenctspSLCWTDGLYTwtiknvtyk 343 cattle
AAB16821     240 NVITDPLTDSIVQLDKNVISLIAtndeAAVNMSLIKEWCKTKTnvtfwnat---venctagALCWEEGNLTwtmlnktwi 316 winter flounder
Q28620       271 KTITEPFTKLIIQLDRSVITSIAtgdeSLRNHSLIRIWCHRDPvea-------------stSMARAETNISrthg----n 333 rabbit
P54463       147 SHLAGPLTKLKTGAD----------------------------------------------------------------- 161 Bacillus subtil...
P32683       227 NNSAANAAARRVALGSLLFKLVG----SLIILPFVHLLAETMG------------------KLSLPKAELV--------- 275 Escherichia coli
BAA87743     206 ASLSASAAARRVTLGNLIVRAIG----CLLILPVADILASWLS------------------MLPVPASKLP--------- 254 Agrobacterium t...
XP_002644362 226 DLLTDPINQLILQK------------------------------------------------------------------ 239 Caenorhabditis ...
CAA57345     344 enIAkcQHIFVNfnlsdaiVGTILLITSLLILCTCLILIVKLLGSVLRGQVAAVIKKTINTDFPYPFSWVTGYLAILVGA 423 cattle
AAB16821     317 inQErcKHIFANttlpdlaVGLILLALSLFVLCTCLILIVKLLNSMLKGQVAVVIKRVINTDFPFPFCWVTGYIAIFVGA 396 winter flounder
Q28620       334 atMEkcNHIFVDtqlpdlaVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVINTDLPAPFTWVTGYFAMVVGA 413 rabbit
P54463       162 -----------------------------------------------------VLY----------HVNDSNWSALLIGM 178 Bacillus subtil...
P32683       276 --IY--FHVFYN-------LVRCLVMLPFVDPMARFCKTIIRDEPELDTQLRPKHLDVSALDTPTLALANAARETLRIGD 344 Escherichia coli
BAA87743     255 --VD--AHLALN-------IGLALLAMPFSRLLARWMGVLIPASEQADN--TPKFLDPDELSTPVVALTSAAREVLGVGD 321 Agrobacterium t...
XP_002644362 240 ---------------------------------------------LLDGHAANYVRNLLSKECPGMFKPCTGYLVMLVG- 273 Caenorhabditis ...
CAA57345     424 GMTFIVQSSSVFTSAMTPLIGIGVISIQRAYPLTLGANIGTTTTAILAALASPGSTLKSSLQIALCHFFFNISGIILWYP 503 cattle
AAB16821     397 GMTFIVQSSSVFTSAITPLVGIGVISLERAYPLTLGSNIGTTTTAILAAMASPAEKLKESLQIALCHFFFNVMGILLFYP 476 winter flounder
Q28620       414 AMTFIVQSSSVFTSAITPLVGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSSFQIALCHFFFNISGILLWYP 493 rabbit
P54463       179 VLTAIIHSSSVCIGILMSFMNEGIIGLTQAMSVVLGSNIGTCITAVMAAVSGG----YAAKQTAYAHVVFNVLGVALVLP 254 Bacillus subtil...
P32683       345 AMEQMMEGLNKVMHGE-PRQEKELRKLADDINV-LYTAIKLYLARMPKEELAEEESRRWAEIIEMSLNLEQASDIVERMG 422 Escherichia coli
BAA87743     322 LIERMLLRVSDAFQQNNAARLKDIAQLERQVDR-LQQEVKVYLSKLGRTGLSEDEGRRSIVIIDYAINLEHIGDIVEKGL 400 Agrobacterium t...
XP_002644362 274 ----LIQSNSIFSSSLTPLVGSGVVSLEQMYPLVLGSNIGTTFSGVLAAFSTDPSRFEKALHMAMCQVIYNIIGTCLFYI 349 Caenorhabditis ...
CAA57345     504 IPFTR-LPIRLAKGLGNISSKYRWFAIVYLIVFFLLIPLAVFGLSLIGWPVLVGVASPIVLVILLVVVLKILQSFCPGsl 582 cattle
AAB16821     477 IPFTR-VPIRLARGLGNHTAKYRWFAGLYLVLCFLVFPLTVFGLSMAGWQVLVGVGVPFVVLIVFVIVVNVMQSRCPRfl 555 winter flounder
Q28620       494 LPCTR-LPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWRAMVGVGAPFGALLAFVVLINVLQSRSPGrl 572 rabbit
P54463       255 F-------LTAATGFVEQLSPDPAQKIAHFSLLFNVVTALLFLPLTNLFYRLIHLLIPAK-------------------- 307 Bacillus subtil...
P32683       423 SEIAD-KSLAARRAFSLDGLKELDALYEQLLSNLKLAMSVFFSGDVTSARRLRRSKHRFRILNRRYSHAHVDRLHQQN-- 499 Escherichia coli
BAA87743     401 LPEVT-KKIAHGLKFSDDGFSELTQLFQLTVDNLRIAQTILITRDINLARQLMERKVEVRHMEKQSSERHLERLRDGR-- 477 Agrobacterium t...
XP_002644362 350 VPCTRkFPVYLSIKLGDITDKYRWFIVVFIITFFLIIPFTIIGLTLLPDNVIVIVFIIILIIALMSVLLCILQNCCVAfl 429 Caenorhabditis ...
CAA57345     583 PQKLRSWDFLPFWMRSLEPWD 603 cattle
AAB16821     556 PKVLQDWDFLPRPLHSMAPWD 576 winter flounder
Q28620       573 PKWLQTWDFLPHWMHSLQPLD 593 rabbit
P54463           ---------------------     Bacillus subtilis subsp. subtilis str. 168
P32683       500 VQSIETSSLHLGLLGDMQRLN 520 Escherichia coli
BAA87743     478 TDSLQTSSLHLDILRDLKRIN 498 Agrobacterium tumefaciens
XP_002644362 430 PPVLHDWKFLPVWMRSLKYYD 450 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap