Conserved Protein Domain Family
BexC_CtrB_KpsE

?
TIGR01010: BexC_CtrB_KpsE 
polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family
This family contains gamma proteobacterial proteins involved in capsule polysaccharide export. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 130083
View PSSM: TIGR01010
Aligned: 8 rows
Threshold Bit Score: 444.161
Threshold Setting Gi: 446353820
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD30161      25 KKLNPLFWVTVAIPTVLSAFYFGSVASDIYISESSFVVRSPKNQTALTGVGALLQGSGFSRAQDDTYTVQEYMHSRTALE 104 Actinobacillus ...
P22930        18 KKMKPLFGLTVLIPTAFSAVYFGLFASDIYVSESSFVVRSPRSQSSLSGVGALLQSTGFSRSQDDTYSVQEYMRSRTALS 97  Haemophilus inf...
AAF08242      10 AN--PLLWLTVIIPTACSGIYYSLFASDIYVSESSFWFRSPNNQSSLTGVGALLQNSGFARSQDDTYSVQEYMRSRTALE 87  Mannheimia haem...
AAC67255      19 RKISTLFKYMVILPTCCSLFYFSLWASDIYISQSSFVVRTPKNQAALSGVGALLQSSGFARAQDDTYTVQEFMRSRSTLE 98  Pasteurella mul...
P32014        27 KKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQSSFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVGEYMRSRSSLD 106 Neisseria menin...
AAC38080      58 KSLQLGSFLWVVICFSIAVLYFGFIASDRYVSRAELMIKQADQVKMLPDALSMLGIGGSN--HQDILLVQDYMKSWDMLA 135 Escherichia coli
P42501        23 DIQKHLAKIIILAPMAMLLIYLAIFSQPRYMSESKVAIKRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLA 102 Escherichia coli
WP_000431675  78 KQSLRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDASQDNFSGTSFFGAGNKMS----EGFQVREFILSKEMMD 153 Salmonella ente...
AAD30161     105 QLMKDLPIREYYENQGDIIARFNGFGL-NNSKEAFYKYFRDRLSVDFDSVSGIASLRIRAFNAEEGQQINQKLLAEGETL 183 Actinobacillus ...
P22930        98 ALEQGLPLRTFYSEKGDLLSRFNGFGL-NDTQEAFYRYFKERLSVDVDSISGIATLRVHAFDAEEGYQINERLLKEGESL 176 Haemophilus inf...
AAF08242      88 QLEAEIPVKRFYSEQGDLLSKFNGLGF-NDTQEAFYRYFKERLNIDVDSISGIATLRVRAFNAEEGQKINENLLQQGETL 166 Mannheimia haem...
AAC67255      99 LLEKSIPIRQFYEDKGDLFSRFNPLNI-FSEQEAFYQYFSKKLSVNFDSVSGIATLNIRAFDPKEAQQINQELLKQGEYL 177 Pasteurella mul...
P32014       107 ELRKILPVREFYETKGDAFSRFNGFGF-RGEEEAFYQYYKNQVMINFDTVSGISTLNVTSFDALESKKINEALLKQGEAL 185 Neisseria menin...
AAC38080     136 KLNKELALKAHFQS--DSADYFSRLHK-GVSREDFLDYYRKHLTLHLDELSGVLTVELQTFDPQYGQRVVELMLKESERF 212 Escherichia coli
P42501       103 ALDKQLNFREAFSHSG--LDFLNHLSK-DETAEGFLKYYKDRINVSYDDKTGLLNIQTTGFSPEFALKFNQTVLKESERF 179 Escherichia coli
WP_000431675 154 RMEKELGFLSYFAQ--DDIALFSRFHApLGINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQH 231 Salmonella ente...
AAD30161     184 INRLNERARKDTISFAEQAVKEAENNVNATASDLSKYRIKNKIFDLPAQSGVQLSLISSLKSELIRVETQLAQLQSITPD 263 Actinobacillus ...
P22930       177 INRLNERARKDTIEFAEQAVKDAEKNVNETAQALSQYRIKNKIFDLPAQSGVQLSLISSLKSELIRVETQLAQLVSITPD 256 Haemophilus inf...
AAF08242     167 INRLNERARQDTVEFAEERVKEAEKDVNNTALALSQYRTKNKIYDLPAQSSVQLSLISTLKSELIRVQTQLAQLKSITPD 246 Mannheimia haem...
AAC67255     178 INRLNERARKDTVMFAELAVSEAEKKVTETSSALSEYRIKNGVFDLQSQSEVQLSLISTLQNELITIQTQLDQVRSISPN 257 Pasteurella mul...
P32014       186 INQLNDRARADTVRYAEEVVKTAAERVKEASQNLTDYRIANGVFDLKAQSEVQMGLVSKLQDELIVIQTQLDQVKAVTPE 265 Neisseria menin...
AAC38080     213 INKLGHQVALEQLAFVEKEVNRAYQRLQDEKAKVLAFQNSHQLLSPESTSSARLGVVSQIEGELVRQQAELKQLRSYMKE 292 Escherichia coli
P42501       180 INEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLMGQKIQMEADLRNLLTYLRE 259 Escherichia coli
WP_000431675 232 VNTVSARMQKERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKAEYAQLMVNGLD 311 Salmonella ente...
AAD30161     264 -NPQVDALLMRQKSLRKEIDEQSKQLSSNs-NSSIAIQTADYQRLVLANELAQQQLTAALTSLQNTKNEADRQQLYLEVI 341 Actinobacillus ...
P22930       257 -NPQVPALQMRQKSLKKEIDEQTRQLSGN--GNSAATQTADYQRLMLANELAQQQLAAAMTSLQNTRGEADRQQLYLEVI 333 Haemophilus inf...
AAF08242     247 -NPQVAALQMRQKSLKKEIDDQSKQLAGG--NTSVATQTAEYQRLVLANELAQQQLAAAMTSLQNTRGEADRQQLYLEVI 323 Mannheimia haem...
AAC67255     258 -NPQVQTLLARANSIRKEMQQQVQQVLGG--GNSIVTQTAEYQRLVLNNTLAQQQLGTAITSLQNARSEADRQQLYLEII 334 Pasteurella mul...
P32014       266 -NPQIPGLQAREQSLRKEIDQQLRAISGGg-HSSLSNQAAEYQRVYLENQLAEQQLAAAMTSLESAKVEADRQQLYLEVI 343 Neisseria menin...
AAC38080     293 tAPAVVSLQGRVDALTKQLEQERAKLTGQd-NDAMNEITAGYMDVQTQATLAADLYKTGLISLEQTRVEAYRKLKHLLVI 371 Escherichia coli
P42501       260 dAPQVVSARNAIQSLQAQIDEEQSKITAPq-GDKLNRMAVDFEEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVI 338 Escherichia coli
WP_000431675 312 qNPLIPRLSAKIKVLEKQIGEQRNRLSNKlgSQGSSESLSLFEDLRLQSEIAKARWESALQTLQQGKLQALRERQYLLII 391 Salmonella ente...
AAD30161     342 SQPSKPDWAEEPYRLYNILATFFIGLMLYGVLSLLIASVREHKN 385 Actinobacillus pleuropneumoniae serovar 1 str. 4074
P22930       334 SQPSKPDWALEPSRIYNIIATFIIGLMLYGVLNLLIASIREHKN 377 Haemophilus influenzae
AAF08242     324 GRPSKPDWALEPYRIYNIISTFFIGLILFGVLSLLLASIREHKN 367 Mannheimia haemolytica
AAC67255     335 SYPNEPDLALEPYRLYNILATLFISLILYGITLLLLASIREHKN 378 Pasteurella multocida
P32014       344 SQPSLPDLAHEPKRLYNIVATLIIGLMVYGILSLLTASIREHKN 387 Neisseria meningitidis MC58
AAC38080     372 TQPTLAEDAEYPRRLYNLATVGVLLCLFYGLIIMGLATLREHQD 415 Escherichia coli
P42501       339 SSPQLPQESSFPNIPYLIACWLLVCCLLFGTLKLLLAVIEDHRD 382 Escherichia coli
WP_000431675 392 SQPMAESDTTRYADGTKWLLFFVLLGITYLVTSLLITIRRMRE- 434 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap