1VS5


Conserved Protein Domain Family
rpsC_bact

?
TIGR01009: rpsC_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S3, bacterial type
This model describes the bacterial type of ribosomal protein S3. Chloroplast and mitochondrial forms have large, variable inserts between conserved N-terminal and C-terminal domains. This model recognizes all bacterial forms and many chloroplast forms above the trusted cutoff score. TIGRFAMs model TIGR01008 describes S3 of the eukaryotic cytosol and of the archaea. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130082
View PSSM: TIGR01009
Aligned: 16 rows
Threshold Bit Score: 291.143
Threshold Setting Gi: 133936
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VS5_C         1 MGQKVHPNGIRLG--IVKPWNSTWFANT-KEFADNLDSDFKVRQYLTKELA--KASVSRIVIERPAKS-IRVTIHTARPG 74  Salmonella ente...
Q9ZCR1         1 MGQKVCAHGFRVGptLIKDWDSILYA-E-KHYKTLFIQDLKIRDLINKWFN--QAQISRVLIERPSNKsIIININAKKPN 76  Rickettsia prow...
O66437         1 MGQKTHPIGFRLG--VIKEWPSKWYAPK-KEYSKLLHEDLKIKNYIKERYK--VAGVSKVEIERIVDK-VRVKIHTARPA 74  Aquifex aeolicu...
P94273         1 MGQKVHPYSLRVK--INKDWKSKWYFDK-KLYSAILHEDFLIRREIMKFLKgiKFDISDIEIIRNNPQkVTVVIVTPRPG 77  Borrelia burgdo...
O83225         1 MGQKVSPIGLRLG--INKVWSSRWYAGP-REYAALLHEDLRIRSMIRSFPEckNADIAEVEIVR-HPQrVTVVMHTARPG 76  Treponema palli...
BAA08837       1 MGQKVNPVGLRIG--VIRDWESKWYAG--KDYADFLHEDLKIREYISKRLS--DASVSKVEIERAANR-VNITIHTAKPG 73  Bacillus subtil...
EUA07187       1 MGQKINPHGFRLG--ITTDWKSRWYAD--KQYAEYVKEDVAIRRLLSSGLE--RAGIADVEIERTRDR-VRVDIHTARPG 73  Mycobacterium x...
WP_010874528   1 MGQKVNSNGLRFG--INKNWISRWTANShAQTAKWLIEDEKIRNLFFVNYR--NAQVSNVEIERTQAT-VDVFVYAAQPA 75  Mycoplasma pneu...
WP_009885841   1 MGQKVNSNGLRFG--INKNWISRWTASSnQQTATWLVQDEKIRNLFFINYR--NAQVSNVEIERTQTT-VDVYVYAAQPA 75  Mycoplasma geni...
AIE75051       1 MGQKIHPVGFRLG--ITKDHKSCWYADP-KRYPELLQEDHKIRQYIEKTLN--NAGISDIRIERKAEQ-IELGIHTARPG 74  Synechocystis s...
1VS5_C        75 IVIGKKGEDVEKLRKVVADIAG--V--PA--QINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRL-GAK 147 Salmonella ente...
Q9ZCR1        77 IIIGKNGTEIDKLKKAIENMTFl-K--EV--YINIHEVRKFNIDAAIVAQTIAAQLEKRVSFRKAMKTAIQASFKQ-GGQ 150 Rickettsia prow...
O66437        75 IVIGRRGQEVENLKKTLEKMLPg-K--EI--TISVVEVRVPELDAQLVAQDIATQIERRVSHRRAMKRAIDNALKA-GAK 148 Aquifex aeolicu...
P94273        78 SVIGLKGSNLEKIGQLLTKKIS--K--KI--SIKIKEVKRPELDAQIIANGIAKQVENRASYRKVLKSSLSTSMLK-GAQ 150 Borrelia burgdo...
O83225        77 VVIGAKGVNIEKIGAEVQKRLN--K--KV--QIKVKEIKRMELNAYLVAQNVARQLTARVSFRKCLRQACAGTMKS-GAQ 149 Treponema palli...
BAA08837      74 MVIGKGGSEVEALRKALNSLTG--K--RV--HINILEIKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRA-GAQ 146 Bacillus subtil...
EUA07187      74 IVIGRRGTEADRIRADLEKLTG--K--QV--QLNILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQpNVK 147 Mycobacterium x...
WP_010874528  76 FLIGSENKNIQKITKQIKQIIG--RttNL--DLTINEIGSPMLSARIIARDLANAIEARVPLRTAMRQSLIKVLKA-GAN 150 Mycoplasma pneu...
WP_009885841  76 LLIGSENKNIQKITKMIQIIVG--R--KIklDLTINEIGSPMLSSRIIARDIANAIENRVPLRSAMRQALTKVLKA-GAN 150 Mycoplasma geni...
AIE75051      75 VVVGRGGSGIEQLREGLQKLLGsaR--QI--RVNVIEVPNADADAALMAEYIGQQLERRVSFRRVVRQALQRAERA-EVK 149 Synechocystis s...
1VS5_C       148 GIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGM 211 Salmonella enterica subsp. ente...
Q9ZCR1       151 GIRVSCSGRLGGAEIARTEWYIEGRMPLHTLRADIDYSTAEAITTYGVIGVKVWIYKGEYKENK 214 Rickettsia prowazekii str. Madr...
O66437       149 GVKVQVKGRIGGAELARKEWFLVGRMPLQTLRADIDYGFATAYTKYGILSVKVWIYKGDVLNGR 212 Aquifex aeolicus VF5
P94273       151 GLKIKIAGRLGGAEIARSFEVKEGRVPLHTLRANIDYGFSEAQTTYGIIGVKVWLFKGEVLGRQ 214 Borrelia burgdorferi B31
O83225       150 GVKIRVSGRLGGAEMSRTEEIKEGRTPLHTLRADIDYGFAEAHTTYGSIGVKVWLYSGMMYGNE 213 Treponema pallidum subsp. palli...
BAA08837     147 GVKTMVSGRLGGADIARPEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTK 210 Bacillus subtilis subsp. subtil...
EUA07187     148 GIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGK 211 Mycobacterium xenopi 4042
WP_010874528 151 GIKVLVSGRLNGAEIARDKMYIEGNMPLSTLRADIDYALEKAQTTYGVIGVKVWINRGMIYTKG 214 Mycoplasma pneumoniae
WP_009885841 151 GIKVLVSGRLNGAEIARDKMYIEGNMPLSTLRADIDYAFEKAKTTYGIIGVKVWINRGMIYAKG 214 Mycoplasma genitalium
AIE75051     150 GIKIQVSGRLNGAEIARTEWVREGRVPLHTLRADIDYAYRTALTTYGILGIKVWIFKGEVIPGQ 213 Synechocystis sp. PCC 6714
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap