Conserved Protein Domain Family
polys_exp_MPA1

?
TIGR01006: polys_exp_MPA1 
polysaccharide export protein, MPA1 family, Gram-positive type
This family contains members from Low GC Gram-positive bacteria; they are proposed to have a function in the export of complex polysaccharides. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 130079
View PSSM: TIGR01006
Aligned: 8 rows
Threshold Bit Score: 284.354
Threshold Setting Gi: 1773340
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC31161   1 MNQDNTktksvEIDILALLHKLWTKKLLILFIAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNN-NLSAQDLQAGT 79  Streptococcus therm...
AAC78665   2 MKEQNTi----EIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKpGLTNQDLQAGT 77  Streptococcus pneum...
AAC38746   1 MKEQNTi----EIDVFQLFKTLWKRKLMILIVALVTGTGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKpGLTNQDLQAGT 76  Streptococcus pneum...
Q54519     1 MKEQNTl----EIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSMTRIYVVNRDQGEKsGLTNQDLQAGS 76  Streptococcus pneum...
AAC44010   1 MNQDNTks--dEIDVLALLHKLWTKKLLILFTAFYFAVFSFLGTYFFIQPTYTSTTRIYVVNQATDNK-NLSAQDLQAGT 77  Streptococcus therm...
P39850     1 --MEST------IDLSELLGRVRKNMKLLIILPLLGLLISAIISFFFLDVKYQASTQILVNQ-KGNDS-QIMAQEVQSNI 70  Staphylococcus aureus
AAC46084   1 --MEST------LELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP-QFMAQEVQSNI 71  Staphylococcus aureus
AAC45228   3 ETQEQT------IDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNS-AAYAGEVTGNI 75  Lactococcus lactis ...
AAC31161  80 YLVNDYKEIITSNDVLSEVIKDEKLNLSEAELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVRKVASGKIKKVTKV 159 Streptococcus therm...
AAC78665  78 YLVKDYREIILSQDVLEKVATNLKLDMPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRV 157 Streptococcus pneum...
AAC38746  77 YLVKDYREIILSQDALEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRV 156 Streptococcus pneum...
Q54519    77 SLVKDYREIILSQDVLEEVVSDLKLDLTPKDLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRV 156 Streptococcus pneum...
AAC44010  78 YLANDYKEIIASNDVLSEVIKDEKLNLSEAELSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASKKIKKVTKV 157 Streptococcus therm...
P39850    71 QLVNTYSEIVKSPRILDKVSKELDDKYSRSEISSMLTVTNQAESQVLNIDVESKSGSNSEKIANKIAEVFSDEVPDIMNV 150 Staphylococcus aureus
AAC46084  72 QLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSV 151 Staphylococcus aureus
AAC45228  76 QMANTINQVIVSPVILDKVRSNLN--LSDDSFQKQVTAANQTNSQVIMLTVKYSNPYIAKKIADETAKIFSSDAAKLLNV 153 Lactococcus lactis ...
AAC31161 160 EDVTTLEEAKLPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVRRPEDVED----VLGMTLLGIIPDTDK 231 Streptococcus thermophilus
AAC78665 158 SDVTTLEEARPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVED----VLQMPLLGVVPDFDK 229 Streptococcus pneumoniae
AAC38746 157 SDVTTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPENVEN----VLKIPLLGLVPDFDK 228 Streptococcus pneumoniae
Q54519   157 SDVTTLEEARPATSPSSPNIKRSTLIGFLAGVIGTSVIVLILELLDTRVKRPKDIED----TLQMTLLGIVPNLNK 228 Streptococcus pneumoniae
AAC44010 158 EDVTTLEEAKLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRVRRPEDVED----ALGMTLLGIVPDTDK 229 Streptococcus thermophilus
P39850   151 DNVSVLSTADNTGKQVAPKPMVNLVVGLVIGLVIALLIIFIKEVFDKRIKTEEEVEN----ELVIPVLGSIQKFD- 221 Staphylococcus aureus
AAC46084 152 DNVSILSKADGTAVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEK----ELGLPVLGSIQKFN- 222 Staphylococcus aureus
AAC45228 154 TNVNILSKAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEAlgltVLGVTSYDQMSDFNK 229 Lactococcus lactis subs...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap