2H2W


Conserved Protein Domain Family
metA

?
TIGR01001: metA 
Click on image for an interactive view with Cn3D
homoserine O-succinyltransferase
The apparent equivalog from Bacillus subtilis is broken into two tandem reading frames. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130074
View PSSM: TIGR01001
Aligned: 5 rows
Threshold Bit Score: 488.586
Threshold Setting Gi: 6969141
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H2W_A        13 MPINVPSGLPAVKVLAkEGIFVMTEKRAIHQDIRPLEILILNLMPDKIKTEIQLLRLLGNTPLQVNVTLLYTETHKPKHT 92  Thermotoga mari...
CAB73712       1 MPLIIPENIPAYELLK-EHAFIMGLRRAKHQDIRPQEILIVNLMPKKIETENQILSLLANSPLQVNITLLATTSYVGKNT 79  Campylobacter j...
AAF94765       7 VPIRIPDQLPASDVLRnENIFVMSESRASTQEIRPLKVLLLNLMPKKIETETQFLRLLSNSPLQVDIELLRIDDRPSKNT 86  Vibrio cholerae...
WP_001122779   1 MPIRVPDELPAVNFLReENVFVMTTSRASGQEIRPLKVLILNLMPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNT 80  Escherichia coli
Q9WZY3         1 MPINVPSGLPAVKVLAkEGIFVMTEKRAIHQDIRPLEILILNLMPDKIKTEIQLLRLLGNTPLQVNVTLLYTETHKPKHT 80  Thermotoga mari...
2H2W_A        93 PIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYEL 172 Thermotoga mari...
CAB73712      80 PFTHLEKFYKGLEEVKKHKFDGAIVTGAPVEQMDFEKVAYWEELLEIFDFLKQNVTSSMYICWGAMAALKYFYGVDKISL 159 Campylobacter j...
AAF94765      87 PEEHLNTFYRQFELVKNRNFDGLIITGAPLGLVQFEDVAYWQHLQNIMAWAKAHVTSTLYICWAAQAGLKLLYNLPKRTR 166 Vibrio cholerae...
WP_001122779  81 PAEHLNNFYCNFEDIQDQNFDGLIVTGAPLGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTR 160 Escherichia coli
Q9WZY3        81 PIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYEL 160 Thermotoga mari...
2H2W_A       173 PQKLSGVYKHRVA-KDSVLFRGHDDFFWAPHSRYTEVKKEDIDKVP---ELEILAESDEAGvyVVANKSERQIFVTGHPE 248 Thermotoga mari...
CAB73712     160 DKKIFGVYKHDKV-SPDLLLTNLDEKVLMPHSRHSSMDEEQILALQkqgKLKILLRNKKIG--SALLRDEKNIFILGHLE 236 Campylobacter j...
AAF94765     167 EEKLSGVYYHDIHkPFHPLLRGFDDRFLAPHSRYADFDAEFLAEHT---DLDILATSDVAGvyLAATKDKRNVFVTGHPE 243 Vibrio cholerae...
WP_001122779 161 TEKLSGVYEHHILhPHALLTRGFDDSFLAPHSRYADFPAALIRDYT---DLEILAETEEGDayLFASKDKRIAFVTGHPE 237 Escherichia coli
Q9WZY3       161 PQKLSGVYKHRVA-KDSVLFRGHDDFFWAPHSRYTEVKKEDIDKVP---ELEILAESDEAGvyVVANKSERQIFVTGHPE 236 Thermotoga mari...
2H2W_A       249 YDRYTLRDEYYRDIgrnlKVPIPANYFPNDDPTKTPiltWWSHAHLFFSNWLNYCIYQKTPYRL 312 Thermotoga maritima
CAB73712     237 YFKETLHQEYVRDN----FIQKAKNYYDKKGNIKYN---WRSNANTIFANWLNYDVYQSTPFVL 293 Campylobacter jejuni subsp. jej...
AAF94765     244 YDAYTLHGEYVRDLgeglNPAIPVNYYPNDNPDNKPcasWRSHGHLLFANWLNYCVYQQTPYDL 307 Vibrio cholerae O1 biovar El To...
WP_001122779 238 YDAQTLAQEFFRDVeaglDPDVPYNYFPHNDPQNTPrasWRSHGNLLFTNWLNYYVYQITPYDL 301 Escherichia coli
Q9WZY3       237 YDRYTLRDEYYRDIgrnlKVPIPANYFPNDDPTKTPiltWWSHAHLFFSNWLNYCIYQKTPYRL 300 Thermotoga maritima MSB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap