Conserved Protein Domain Family
ispZ

?
TIGR00997: ispZ 
intracellular septation protein A
This partially characterized protein, whose absence can cause a cell division defect in an intracellularly replicating bacterium, is found only so far only in the Proteobacteria. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 130070
View PSSM: TIGR00997
Aligned: 8 rows
Threshold Bit Score: 150.177
Threshold Setting Gi: 8134519
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9XD50     9 IKPFLDWIPLIVFFYIYKTTEgegsehIIAATTGLLIATLIVYGLMFVLQKfTLEKRQWLVVVLTVVFGGLTMAFQDDFY 88  Vitreoscilla sp. C1
P21366     1 MKQFLDFLPLVVFFAFYKIYD------IYAATAALIVATAIVLIYSWVRFR-KVEKMALITFVLVVVFGGLTLFFHNDEF 73  Escherichia coli
P42397     1 MKKILNLLPIFTFFIFYRFYD------IFIASKSLIFISGLTCLLYWIIYK-EIDKINLFSFITIAIFGSLTIIFHNSQF 73  Buchnera aphidicola...
P43810     1 MKQLLDFIPLILFFITYKLGG------VREAAIVLVVATILQIVILKWKYG-MVEKQQKIMASAVVFFGLLTAYFNEIRY 73  Haemophilus influen...
Q9JR24     1 MKFVSDLLSVILFFATYTVTKn-----MIAATAVALVAGVVQAAFLYWKYK-KLDTMQWVGLVLIVVFGGATIVLGDSRF 74  Neisseria meningiti...
Q9ZDD9     2 LKLLSEIGPVIAFFAGFFYGGg-----IQNATLYMLITSIICITLCYIIDK-KVSKLSIISSTVLFISGIITLISGDSMY 75  Rickettsia prowazek...
AAA26197   1 -KLATELGPLLVFFFVNAKFN------LFAATGAFMVAIVAAMIASYVVTR-HIPIMAIVTGVIVLVFGTLTLVLHDETF 72  Bradyrhizobium japo...
AAD56919  20 VKMAIDLRPLVIFSLAYKMTG------SFIGTIAFMVSMIVAIGVSRYKLG-RVSPTLWLSFVLIMFFGGLTLWFHDQRF 92  Zymomonas mobilis s...
Q9XD50    89 IRLKAPIINAVFAFGLAMSPLFLGgTPGIQKMLGPIFE-MTPKQWMKLNWVWVGFFTLMAVLQALFAFVW-VEYWAMFTA 166 Vitreoscilla sp. C1
P21366    74 IKWKVTVIYALFAGALLVSQWVMK-KPLIQRMLGKELT-LPQPVWSKLNLAWAVFFILCGLANIYIAFWLpQNIWVNFKV 151 Escherichia coli
P42397    74 IKWKITIIYMIFSVILFISQFFMK-KPIIQRFLEKDIK-ISDLYWKKINFFWALFFLFCSILNIYVALCLpEKIWVNFKV 151 Buchnera aphidicola...
P43810    74 LQWKVTIINGLFAIVLLVAQFQFK-TPLIKKLLGKELQ-LPEKAWNTLNFGWAIFFIICMLVNIYISHNMsEEAWVDFKS 151 Haemophilus influen...
Q9JR24    75 IMWKPSVLFWLGALFLWGSHLAGK-N-GLKASIGREIQ-LPDAVWAKLTYMWVGFLIFMGIANWFVFTRF-ESQWVNYKM 150 Neisseria meningiti...
Q9ZDD9    76 IKIKPTILYVIFGIIFLMSGIKKN--PFIKYALESIVR-LKEESWIILSYRTAAFFFFMAVVNEVVWRNFsDETWVKFKV 152 Rickettsia prowazek...
AAA26197  73 IKVKPTIIYGLFAAILGGGLLFGR--SFIAVMFDQMFN-LTPQGWRILTLRWALFFAGMAVLNEIVWRTQsTDFWVNFKV 149 Bradyrhizobium japo...
AAD56919  93 IQLKPTIIYSYFAVMLLGGRLLNK--PMLKYIMEDAFDgVTEKGWLILSFNWGCFFLVMALLNEYLRTHFsFDVWLTLKI 170 Zymomonas mobilis s...
Q9XD50   167 FGDMIVMVVFMVAQFWFLRGFMRKDIK 193 Vitreoscilla sp. C1
P21366   152 FGLTALTLIFTLLSGIYIYRHMPQEDK 178 Escherichia coli
P42397   152 FGLSFLMFLSILITSIYINFKMLKEK- 177 Buchnera aphidicola str. Sg (Schizaphis graminum)
P43810   152 FGIIGMTVIATIISGVYIYRYLPKDGS 178 Haemophilus influenzae Rd KW20
Q9JR24   151 FGSTALMLVFFIIQGIYLSTCLKKED- 176 Neisseria meningitidis serogroup A
Q9ZDD9   153 FGVIPITFIFILLQLPLLLKNKLPDSK 179 Rickettsia prowazekii str. Madrid E
AAA26197 150 FGVTPITMIFAIAQMPLTKRYHLEPVS 176 Bradyrhizobium japonicum
AAD56919 171 WGAMILSAVFGFANMPVLIKNGLNTGN 197 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap