Conserved Protein Domain Family
3a0901s03IAP75

?
TIGR00992: 3a0901s03IAP75 
chloroplast envelope protein translocase, IAP75 family
Two families of proteins are involved in the chloroplast envelope import appartus.They are the three proteins of the outer membrane (TOC) and four proteins in the inner membrane (TIC). This family is specific for the TOC IAP75 protein. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130065
View PSSM: TIGR00992
Aligned: 3 rows
Threshold Bit Score: 979.444
Threshold Setting Gi: 499174555
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA53275      92 GGAGGGGGGSSSSGGGGGGWfNGD----EGSFWSRILSPARAIADEPKSEDWDSHELPADITVLLGRLSGFKKYKISDIL 167 pea
CAB51191     102 GGGGGGDGNFGGFGGGGGGG-DGN----DGGFWGKLFSPSPAVADEEQSPDWDSHGLPANIVVQLNKLSGFKKYKVSDIM 176 thale cress
WP_010872142 117 GNLDVGVDDLPPMAPVDSAElAQAnelpHGNAVAQVAPRVAQVEQENLIAETKTDNQTDHVEPQSPLMAQAAVEEEVEAV 196 Synechocystis s...
AAA53275     168 FFDRNKKSKVETQDSFLDMVSLKPGGVYTKAQ--------------------------------LQKELESLATCGMFEK 215 pea
CAB51191     177 FFDRRRQTTIGTEDSFFEMVSIRPGGVYTKAQ--------------------------------LQKELETLATCGMFEK 224 thale cress
WP_010872142 197 EMEATEETTGVTEETPEETPSFTPDAPPTNTEgtpgptqtlpsftppaspstttpapaeeeprvLVSEVLVTGTTPELEL 276 Synechocystis s...
AAA53275     216 VDMEGKTNADGSLGLTISFAESMWERADRFRCINVGLMGQSKPVEMDPDMSEKEKIEFFRRQEREYKRRISSARPCLLPT 295 pea
CAB51191     225 VDLEGKTKPDGTLGVTISFAESTWQSADRFRCINVGLMVQSKPIEMDSDMTDKEKLEYYRSLEKDYKRRIDRARPCLLPA 304 thale cress
WP_010872142 277 LVYNAIRTQPGRTTTRTQLQEDVNAIYATGYFSNVRVAPSDTPLGVRVTFEVQANPVFTG-LNIRTVPETAEGKERILPQ 355 Synechocystis s...
AAA53275     296 SVHEEIKDMLAEQGRVSARLLQKIRDRVQSWYHEEGYACAQVVNFGNLNTR-EVVCEVVEGDITKLSIQYLDKLGNVVEG 374 pea
CAB51191     305 PVYGEVMQMLRDQGKVSARLLQRIRDRVQKWYHDEGYACAQVVNFGNLNTK-EVVCEVVEGDITQLVIQFQDKLGNVVEG 383 thale cress
WP_010872142 356 EVVDETFGEQYG-KILNLRELQEGIKTINEWYSNQGYDLAQVVGSPQVGADgQVTLVIAEGIVENIQVRFFDSEDEPVQG 434 Synechocystis s...
AAA53275     375 NTEGPVVQRELPKQLLPGHTFNIEAGKQALRNINSLALFSNIEVNPRPDEMNEGSIIVEIKLKELEQKSAEVSTEWSIVP 454 pea
CAB51191     384 NTQVPVVRRELPKQLRQGYVFNIEAGKKALSNINSLGLFSNIEVNPRPDEKNEGGIIVEIKLKELEQKSAEVSTEWSIVP 463 thale cress
WP_010872142 435 RTRDFIITREMR--LKPGDVFNRNRAQTDLQRVYSLGLFEDVRLSFNPGS-DPTEVIVNVDVVEGNTG--------SIAA 503 Synechocystis s...
AAA53275     455 GRGGRPTLASLQPGGTITFEHRNLQGLNRSLTGSVTTSNFLNPQDDLAFKMEYAHPYLDGVDNPRNRTLRVSCFNSRKLS 534 pea
CAB51191     464 GRGGAPTLASFQPGGSVTFEHRNLQGLNRSLMGSVTTSNFLNPQDDLSFKLEYVHPYLDGVYNPRNRTFKTSCFNSRKLS 543 thale cress
WP_010872142 504 GGG---ISSSSGLFGTISYQERNLGGNNQTIGVEAQVG-----QRELLFDVSFTDPWIGGD--PFRTSYTANLFRRRTIS 573 Synechocystis s...
AAA53275     535 PVFTGGPG----VDEVPSIWVDRAGVKANITENFSRQSKFTYGLVMEEIITRDESNHICSNGQRVLPNGAIS-ADGPPTT 609 pea
CAB51191     544 PVFTGGPG----VEEVPPIWVDRAGVKANITENFTRQSKFTYGLVMEEITTRDESSHIAANGQRLLPSGGIS-ADGPPTT 618 thale cress
WP_010872142 574 LVFDGADSsirtFNGFDSPRVVRTGLGLTFFRPIADDVFAPPDWRLSAGFGYQNVRIENAAGALSPFSAPLNgFNSQPLS 653 Synechocystis s...
AAA53275     610 LSGTGIDRMAFLQANITRDNTRFVNGTIVGSRNMFQVDQGLGVGSNFPFFNRHQLTVTKFLQLMSVEEG----AGKSPPP 685 pea
CAB51191     619 LSGTGVDRMAFLQANITRDNTKFVNGAVVGQRTVFQVDQGLGIGSKFPFFNRHQLTMTKFIQLREVEQG----AGKSPPP 694 thale cress
WP_010872142 654 FSDYGVDELFTLSFGASQDNRNNALQPTSGSLVRFGAEQTIPVGTGNIMMTRLRGSYSYYIPVNWLDLTgfglVESTQPQ 733 Synechocystis s...
AAA53275     686 VLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILELAAEIRIPIKGTH-VYAFAEHGTDLGSSKDVKGNP 764 pea
CAB51191     695 VLVLHGHYGGCVGDLPSYDAFVLGGPYSVRGYNMGELGAARNIAEVGAEIRIPVKNTH-VYAFVEHGNDLGSSKDVKGNP 773 thale cress
WP_010872142 734 TVAFNVQAGTVLGDLPPYEAFILGGSNSVRGYQEGELGNGRSFFQATAEYRFPIIAAVgGALFVDYGSNLGSQGAVPGFP 813 Synechocystis s...
AAA53275     765 TVVYRRMGQGSSYGAGMKLGLVRAEYAVDH---NSGTGAVFFRFGERF 809 pea
CAB51191     774 TAVYRRTGQGSSYGAGVKLGLVRAEYAVDH---NNGTGALFFRFGERY 818 thale cress
WP_010872142 814 AIVRGLPGSGVGYGLGVRIQSPVGPIRIDLgftGEGESRINFGIGEKF 861 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap