Conserved Protein Domain Family
3a0901s02IAP34

?
TIGR00991: 3a0901s02IAP34 
GTP-binding protein (Chloroplast Envelope Protein Translocase)
[Transport and binding proteins, Nucleosides, purines and pyrimidines]
Statistics
?
PSSM-Id: 130064
View PSSM: TIGR00991
Aligned: 3 rows
Threshold Bit Score: 597.651
Threshold Setting Gi: 25091388
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD09203   1 MAALq-TLREWIGIQQFPPATQSKLLEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGLRPTLV 79  thale cress
CAB65537   1 MASP--IPREWVGLQQFPPATQTELHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGERIATVSAFQSEGLRPMMW 78  Zea mays
Q41009     1 MASQqqTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV 80  pea
AAD09203  80 SRTRSGFTLNIIDTPGLIEGGYVNDQAINIIKRFLLNMTIDVLLYVDRLDVYRVDDLDRQVVGAITDAFGKEIWKKSALV 159 thale cress
CAB65537  79 SRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDVLLYVDRLDAYRMDTLDGQVIRAITNSFGKDIWRRSLVV 158 Zea mays
Q41009    81 SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVA 160 pea
AAD09203 160 LTHAQFSPPDGLNYNHFVSKRSNALLKVIQTGAQLKKQDLQGFSIPVILVENSGRCHKNESDEKILPCGTSWIPNLFNKI 239 thale cress
CAB65537 159 LTHAQLSPPDGIEYNDFFTRRSEALLRYIHSGAGIKKREYGDFPLPIALVENSGRCKTNEHGEKILPDGTPWVPKLMKEI 238 Zea mays
Q41009   161 LTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKK-DAQASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTI 239 pea
AAD09203 240 TEISFNGNKAIHVDKKLVEGPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKLAWELRDSGLA---------- 309 thale cress
CAB65537 239 TVVISNGSKPIHVDQKLIDGPNPNNRWKMFIPIILAVEYFLVVKGIRRAIHADIANGKVDDWEQRYRDLVgsrdpveqkg 318 Zea mays
Q41009   240 TEVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEALIRRDIATETKPAWETRDVG------------ 307 pea
AAD09203 310 ----SRRS 313 thale cress
CAB65537 319 sttrNRKA 326 Zea mays
Q41009   308 ----DRK- 310 pea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap