Conserved Protein Domain Family
3a0801s07tom40

?
TIGR00989: 3a0801s07tom40 
mitochondrial import receptor subunit Tom40
The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents.These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom40 proteins. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130062
View PSSM: TIGR00989
Aligned: 3 rows
Threshold Bit Score: 283.318
Threshold Setting Gi: 127218
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P23644    57 LVNPGTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALFANDNLFAQGNIDNDLS 136 Saccharomyces cerev...
BAA21446  27 LINPGTCENLSKEVSKDILLSNYAFTGVRADVTKGFCTSPWFTVSHAFALGSQVLPPYSFSTMFGGEPLFLRGSVDNDGA 106 fission yeast
P24391    38 LSNPGTIETIAREVQRDTLLTNYMFSGLRADVTKAFSLAPLFQVSHQFAMG-ERLNPYAFAALYGTNQIFAQGNLDNEGA 116 Neurospora crassa O...
P23644   137 VSGRLNYGWDKKNISKVNLQISDGQ-PTMCQLEQDYQASDFSVNVKTLNPSFSEKgeFTGVAVASFLQSVTPQLALGLET 215 Saccharomyces cerev...
BAA21446 107 VQAMLNCTWNSNVLSKVQMQLSNGAvPNMCQIEHDHKGKDFSFSFKAMNPWYEEK--LTGIYIISLLQSVTPKLSLGVEA 184 fission yeast
P24391   117 LSTRFNYRWGDRTITKTQFSIGGGQ--DMAQFEHEHLGDDFSASLKAINPSFLDGg-LTGIFVGDYLQAVTPRLGLGLQA 193 Neurospora crassa O...
P23644   216 LYS 218 Saccharomyces cerevisiae S288c
BAA21446 185 LWQ 187 fission yeast
P24391   194 VWQ 196 Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap