1IHF


Conserved Protein Domain Family
hip

?
TIGR00988: hip 
Click on image for an interactive view with Cn3D
integration host factor, beta subunit
This protein forms a site-specific DNA-binding heterodimer with the homologous integration host factor alpha subunit. It is closely related to the DNA-binding protein HU. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130061
View PSSM: TIGR00988
Aligned: 4 rows
Threshold Bit Score: 166.238
Threshold Setting Gi: 547714
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IHF_B  1 MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF 80  Escherichia coli BW2952
Q51473  1 MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHF 80  Pseudomonas aeruginosa...
Q06607  1 MIRSELIAKIAEENPHLFQRDVEKIVNTIFEEIIEAMARGDRVELRGFGAFSVKKRDARTGRNPRTGTSVAVDEKHVPFF 80  Rhodobacter capsulatus
P08756  1 MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF 80  Escherichia coli
1IHF_B 81 KPGKELRDRANIYG 94  Escherichia coli BW2952
Q51473 81 KPGKELRDRVNEPE 94  Pseudomonas aeruginosa PAO1
Q06607 81 KTGKLLRDRLNGGE 94  Rhodobacter capsulatus
P08756 81 KPGKELRDRANIYG 94  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap