1IHF


Conserved Protein Domain Family
himA

?
TIGR00987: himA 
Click on image for an interactive view with Cn3D
integration host factor, alpha subunit
This protein forms a site-specific DNA-binding heterodimer with the integration host factor beta subunit. It is closely related to the DNA-binding protein HU. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130060
View PSSM: TIGR00987
Aligned: 4 rows
Threshold Bit Score: 158.517
Threshold Setting Gi: 151944
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IHF_A     2 ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTF 81  Escherichia coli BW...
Q51472     3 ALTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQRPGRNPKTGEEIPITARRVVTF 82  Pseudomonas aerugin...
AAA26128   5 TLTRMDLSEAVFREVGLSRNESAQLVETVLQHMSDALVRGETVKISSFGTFSVRDKTSRMGRNPKTGEEVPISPRRVLSF 84  Rhodobacter capsulatus
P06984     2 ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTF 81  Escherichia coli
1IHF_A    82 RPGQKLKSRVENASPK 97  Escherichia coli BW2952
Q51472    83 RPGQKLKARVEAYAGT 98  Pseudomonas aeruginosa PAO1
AAA26128  85 RPSHLMKDRVAERNAK 100 Rhodobacter capsulatus
P06984    82 RPGQKLKSRVENASPK 97  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap