Conserved Protein Domain Family
3a0801s03tim44

?
TIGR00984: 3a0801s03tim44 
mitochondrial import inner membrane, translocase subunit
The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents.These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tim proteins. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130057
View PSSM: TIGR00984
Aligned: 4 rows
Threshold Bit Score: 530.217
Threshold Setting Gi: 400272
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O60084  41 DTFRAELKKSQELQDSVKALQDSSGSLSESDTFKKARDAYEKARSGTTAASSFTGKTVGKAGAKIGSYAQKAWESAPVQL 120 Schizosaccharomyces p...
O35857  65 DNIKQELAKNKEMKESIKKFRDEAKKLEESDALQEARRKYKSIESETVRTSEAIKKKLGELTGTVKESLDEVSKSDLGRK 144 house mouse
O02161  44 DNVRDEMQKNKELQEHQQQLKARMQELNESDALKDARKKFEIVEKETLKSSEVVKQKIEELSDHMKKMVHEIQKTEAGKK 123 Caenorhabditis elegans
Q01852  56 DTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRG----STIVGKTLKKTGETMEHIATKAWESELGKN 131 Saccharomyces cerevis...
O60084 121 SKKVISSTANTV---ATGVDTATKPVRETAFYKTIKQTMSDGSTSSRYGFYADKEQRKKLRE-EFERR--NRMFASSARI 194 Schizosaccharomyces p...
O35857 145 IKEGVEEAARTAkqsAESVSKSGEKLGKTAAFKAISQGVESVKKELDESVLGQTGPYRRPERlRKRTEfaGAKFKESKVF 224 house mouse
O02161 124 MTEAGAEALKQArkaAEHVEKVAEKVGDTEVYKHVSTSMKTVKDEIDN--IADVRMYSRPEAlTKRTD--GFDLEKERVV 199 Caenorhabditis elegans
Q01852 132 TRKAAAATA-------KKLDESFEPVRQTKIYKEVSEVIDDG-ESSRYGGFITKEQRRLKRErDLASG--KRHRAVKSNE 201 Saccharomyces cerevis...
O60084 195 QPNEDVQSVVVHSNPSWKNKVEQIKNESRLVRKIQELK-KSYQESEHPIVSSIRDMADSISGVWSRMFSETEASQVMRRF 273 Schizosaccharomyces p...
O35857 225 EANEEALGVVLHKDSKWYQQWKDFKDNNVVFNRFFEMK-MKYDESDNVLIRASRALTDKVTDLLGGLFSKTEMSEVLTEI 303 house mouse
O02161 200 EANDSATDVTLHKDSKWYSGWKNFSESNTYYHKLLDWK-IKYDESDNMAVRMMRGVTEKIGSVFSG---QNEVSEVLTEI 275 Caenorhabditis elegans
Q01852 202 DAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKnKLWDESENPLIVVMRKITNKVGG----FFAETESSRVYSQF 277 Saccharomyces cerevis...
O60084 274 KEIDPSFNTEHFLQYLREYIVPEVTEAYVKGDKEVLKTWLSEAPFSVYETTTKEYAKHGVVSV-GKILDIRGVDIMSQRL 352 Schizosaccharomyces p...
O35857 304 LRVDPTFDKDHFLHQCETDIIPNILEAMISGELDILKDWCYEATYSQLAHPIQQAKALGFQFH-SRILDISNVDLAMGKM 382 house mouse
O02161 276 HKIDANFDKQEWLRFCETKIIPNILEAFIRFDLEVLQSWCHERAYTQLSTVVKEYQKMHFSTKdSRIIDINKVEMATGKM 355 Caenorhabditis elegans
Q01852 278 KLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYAD-GRILDIRGVEIVSAKL 356 Saccharomyces cerevis...
O60084 353 LQPNdiPVFIVTFRTQEVHMFKDASsGELVAGKDDRIQQCTYASVFTRVEDELDnpETRGWRIVD 417 Schizosaccharomyces pombe 972h-
O35857 383 MEQG--PVLIVTFQAQVVMVIKNSK-GEVYDGDPDKVQRMLYVWALCRDQEELN--PYAAWRLLD 442 house mouse
O02161 356 MEQG--PVLIISFQVYMINVTKNAD-GKVVEGDPDNPKRINHIWVLCRDVEEYN--PALAWKLLE 415 Caenorhabditis elegans
Q01852 357 LAPQdiPVLVVGCRAQEINLYRKKKtGEIAAGDEANILMSSYAMVFTRDPEQIDddETEGWKILE 421 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap