Conserved Protein Domain Family
3a0801s02tim23

?
TIGR00983: 3a0801s02tim23 
mitochondrial import inner membrane translocase subunit tim23
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130056
View PSSM: TIGR00983
Aligned: 4 rows
Threshold Bit Score: 193.131
Threshold Setting Gi: 603056
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P32897    61 LAG-LDKGVEYLDLEEEQLSSLEGSQgliPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQGLQNIPPNSPGKLQLNTVLN 139 Saccharomyces cerev...
CAB53081  47 LAD-LDKPLDYLLIEEDALSTLPGDSmaiPSRGWQDDLCYGTGTSYLSGLAIGGLWGLNEGMKKTKDITSTRLRLNGILN 125 fission yeast
AAA57314  34 LYK-LPTSPEFLFTEEALR----------QRRSWGENLTFYTGTAYLGGSVAGASVGVITGVKSFESGDTTKLKINRILN 102 thale cress
BAA21819  42 LSPyLNVDPRYLVQDTDEFILPTGAN---KTRGRFELAFFTIGGCCMTGAAFGALNGLRLGLKETQSMPWSKPRNVQILN 118 Norway rat
P32897   140 HITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVW 212 Saccharomyces cerevisiae S...
CAB53081 126 GVTRRGPFVGNSLGVLALVYNGINSLIGYKRQKHGWENSVAAGALTGALYKSTRGLRAMAISSSLVATAAGIW 198 fission yeast
AAA57314 103 SSGQTGRTWGNRIGIIGLVYAGIESGIVAATDRDDVWTSVVAGLGTGAVCRAARGVRSAAVAGALGGLAAGAV 175 thale cress
BAA21819 119 MVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDFNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSVY 191 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap