1VS5


Conserved Protein Domain Family
rpsL_bact

?
TIGR00981: rpsL_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S12, bacterial/organelle
This model recognizes ribosomal protein S12 of Bacteria, mitochondria, and chloroplasts. The homologous ribosomal proteins of Archaea and Eukarya, termed S23 in Eukarya and S12 or S23 in Archaea, score below the trusted cutoff. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130054
View PSSM: TIGR00981
Aligned: 15 rows
Threshold Bit Score: 195.39
Threshold Setting Gi: 2500446
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VS5_L         1 MATVNQLVRKPRARKVAKSNVPALEA-------------CPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYI 67  Salmonella ente...
O83271         1 MPTINQLTRIGRKAVFSRTKSPALQA-------------CPQKRGVCTRVMTVTPKKPNSALRKVARVRLSSGVEVTAYI 67  Treponema palli...
Q9Z800         1 MPTINQLIRKRRKSSLARKKSPALQK-------------CPQKRGVCLQVKTKTPKKPNSALRKVAWVRLSNGQEVIAYI 67  Chlamydia pneum...
P41082         1 MPTYNQLVRFGRKSKTRKTKSPALES-------------NPFKSGVCLVVKTVTPKKPNSALRKIATVRLSNKRTVNAYI 67  Rickettsia prow...
O70089         1 MPTFNQLVKYGREKRKKKSKAPALQG-------------CPQKRGVCVRVYTVTPKKPNSALRKVARVRLSNGIEVTAYI 67  Aquifex aeolicu...
P56019         1 MPTINQLIRKERKKVVKKTKSPALVE-------------CPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYI 67  Helicobacter py...
P74230         1 MPTIQQLIRSERSKVQKKTKSPALKQ-------------CPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYI 67  Synechocystis s...
P41196         1 MPTIQQLVRKGRRDKISKVKTAALKG-------------SPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYI 67  Mycobacterium t...
WP_002656492   1 MPTINQLIRKPRKSQTEKTASPALQN-------------CPQRRGICTRVMTVTPKKPNSALRKVARVRLSNGFEVTAYI 67  Borrelia burgdo...
BAA11001       1 MPTINQLIRKGRVSKVENSKSPALNKgynsfkkehtnvsSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYI 80  Bacillus subtil...
1VS5_L        68 GGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA 124 Salmonella enterica subsp. enterica se...
O83271        68 PGIGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGAKDTLGVVDRKRGRSKYGAKRPRA 124 Treponema pallidum subsp. pallidum str...
Q9Z800        68 GGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDCAAVKNRKQSRSRYGAKRPK- 123 Chlamydia pneumoniae
P41082        68 PGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDIAGVKGRKQGRSRYGAHRKQV 124 Rickettsia prowazekii str. Madrid E
O70089        68 PGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGTKRPKE 124 Aquifex aeolicus VF5
P56019        68 PGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKA 124 Helicobacter pylori
P74230        68 PGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGTKREKA 124 Synechocystis sp. PCC 6803 substr. Kazusa
P41196        68 PGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG 124 Mycobacterium tuberculosis
WP_002656492  68 PGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDTLGVNNRKKGRSKYGTKKPKA 124 Borrelia burgdorferi group
BAA11001      81 PGIGHNLQEHSVVLIRGGRVKNLPRVRYHIVRGALDTAGVENRAQGRPKYGTKKPKA 137 Bacillus subtilis subsp. subtilis str....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap