
Conserved Protein Domain Family

TIGR00981: rpsL_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S12, bacterial/organelle
This model recognizes ribosomal protein S12 of Bacteria, mitochondria, and chloroplasts. The homologous ribosomal proteins of Archaea and Eukarya, termed S23 in Eukarya and S12 or S23 in Archaea, score below the trusted cutoff. [Protein synthesis, Ribosomal proteins: synthesis and modification]
PSSM-Id: 130054
Aligned: 15 rows
Threshold Bit Score: 195.39
Threshold Setting Gi: 2500446
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O83271        68 PGIGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGAKDTLGVVDRKRGRSKYGAKRPRA 124 Treponema pallidum subsp. pallidum str...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap