Conserved Protein Domain Family
3a0801so1tim17

?
TIGR00980: 3a0801so1tim17 
mitochondrial import inner membrane translocase subunit tim17
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130053
View PSSM: TIGR00980
Aligned: 4 rows
Threshold Bit Score: 275.564
Threshold Setting Gi: 3219814
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB92039   1 MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAKGK--KLVGMMREVRMRSTLTGVQFAAWGGMFSTIDCCL 78  Caenorhabditis elegans
AAD19594   1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGInhRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCSM 80  house mouse
P39515     2 SADHSRDPCPIVILNDFGGAFAMGAIGGVVWHGIKGFRNSPLGE--RGSGAMSAIKARAPVLGGNFGVWGGLFSTFDCAV 79  Saccharomyces cerev...
P87130     3 SADHTRDPCPYVILNDFGAAFSMGTIGGAIWHSIKGWRNSPPGE--KRISAIAAAKTRAPVLGGNFGVWGGLFSTFDCAV 80  Schizosaccharomyces...
AAB92039  79 VAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVILAMIEGVGLVTTRWMGAMMDPTqppPEALDDPRSLGQK 158 Caenorhabditis elegans
AAD19594  81 VQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNG---PQFTEDHSQLPSS 157 house mouse
P39515    80 KAVRKREDPWNAIIAGFFTGGALAVRGGWRHTRNSSITCACLLGVIEGVGLMFQRYAAWQAKPMa--PPLPEAPSSQPLQ 157 Saccharomyces cerev...
P87130    81 KGVRRKEDPWNAIIAGFFTGGALAVRGGWRATRNGAIGCACILAVFEGLGIALGRMNAEYNRPVa--PVIPDAPASGSTS 158 Schizosaccharomyces...
AAB92039 159 S-QAEPGLDQTRPFG 172 Caenorhabditis elegans
AAD19594 158 Q-LPSSPFGDYRQYQ 171 house mouse
P39515   158 A-------------- 158 Saccharomyces cerevisiae S288c
P87130   159 AaPAAV--------- 164 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap