1FUO,1YFM


Conserved Protein Domain Family
fumC_II

?
TIGR00979: fumC_II 
Click on image for an interactive view with Cn3D
fumarate hydratase, class II
Putative fumarases from several species (Mycobacterium tuberculosis, Streptomyces coelicolor, Pseudomonas aeruginosa) branch deeply, although within the same branch of a phylogenetic tree rooted by aspartate ammonia-lyase sequences, and score between the trusted and noise cutoffs. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130052
View PSSM: TIGR00979
Aligned: 11 rows
Threshold Bit Score: 907.57
Threshold Setting Gi: 490733854
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FUO_A         4 VRSEKDSMGAIDVPADKLWGAQTQRSLEHFRIS--TEKMPTSLIHALALTKRAAAKVNEDLGLLSEEKASAIRQAADEVL 81  Escherichia coli
O25883         3 FRIEHDTMGEIKVNDSQYWGAQTQRSLENFKIG--TEKMPKELIGAFAKLKRSLAVVNHKLGKLSLEKSQAIIKACDCIL 80  Helicobacter py...
P07343         3 YRIERDTMGEVKVPADKFWGAQTQRSKENFKIG--SEKMPMRVVKAFAILKRSTALANKRLGNLDAEKAEAIAAVCDDVL 80  Bacillus subtil...
P05042         4 VRSEKDSMGAIDVPADKLWGAQTQRSLEHFRIS--TEKMPTSLIHALALTKRAAAKVNEDLGLLSEEKASAIRQAADEVL 81  Escherichia col...
P08417        28 FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGgaRERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVA 107 Saccharomyces c...
WP_010883646   1 MRQEKDSLGIVEVPEDKLYGAQTMRSRNFFSWG--PELMPYEVIRALVWIKKCAAQANQDLGFLDSKHCDMIVAAADEIL 78  Chlamydia pneum...
WP_010873427   5 HRLETDSMGSLEVQADRLWGAQTQRSLMFFDIG--SDVMPPDLIRAFAILKKAAAITNQDLGKLPADKAELIITAADEII 82  Synechocystis s...
WP_009872244   1 MRQENDSLGIVLVPEDKLFGAQTGRSQEFFSYG--KESMPLEIIHALVKIKKCAAKANGDLGCLDAKRRDMIVAATDEIL 78  Chlamydia trach...
P71384         3 FRIEKDTMGEVQVLADKYWAAQTERSRNNFKIGp-AASMPHEIIEAFGYLKKAAAFANHDLGVLPLEKRDLIALACDEIL 81  Haemophilus inf...
1YFM_A        28 FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGgaRERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVA 107 baker's yeast
WP_004596191   4 YRIESDSFGEIQIEEKFYWGAQTQRSLNNFKIS--KQKMPKILIRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRIL 81  Rickettsia prow...
1FUO_A        82 AGQHDDEFPLAIWQTGSGTQSNMNMNEVLANRASELLGGVRGMERKVHPNDDVNKSQSSNDVFPTAMHVAALLALRKQLI 161 Escherichia coli
O25883        81 KGELCGEFPLAIWQTGSGTQTNMNLNEVIANKATEILGGNFREKKLIHPNDDVNMSQSSNDTFPTAMHIVSVLEITHRLL 160 Helicobacter py...
P07343        81 KGKYDDNFPLVVWQTGSGTQSNMNMNEVVANRATALLKEKNSDQ-TIHPNDDVNRSQSSNDTFPTAMHVAAVLAVYEQLV 159 Bacillus subtil...
P05042        82 AGQHDDEFPLAIWQTGSGTQSNMNMNEVLANRASELLGGVRGMERKVHPNDDVNKSQSSNDVFPTAMHVAALLALRKQLI 161 Escherichia col...
P08417       108 SGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQ-VHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELI 186 Saccharomyces c...
WP_010883646  79 EGGFEEHFPLKVWQTGSGTQSNMNVNEVIANLAIRHHGGVLGSKDPIHPNDHVNKSQSSNDVFPTAMHIAAVISLKNKLI 158 Chlamydia pneum...
WP_010873427  83 AGQWLDHFPLRIWQTGSGTQTNMNVNEVIANRAIAICGGELGSKNPIHPNDHVNMSQSSNDTFPTAMHIAAVAGLQTKLI 162 Synechocystis s...
WP_009872244  79 SGEFDEHFPLKVWQTGSGTQSNMNVNEVIANLAIQRHGGELGSKHPVHPNDHVNKSQSSNDVFPTAMHIAAVQSIKGSLI 158 Chlamydia trach...
P71384        82 ANKLDDQFPLVIWQTGSGTQSNMNVNEVVANRAHVLNGGKLGEKSIIHPNDDVNKSQSSNDTFPTAMHIAAYKKVVEHTI 161 Haemophilus inf...
1YFM_A       108 SGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQ-VHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELI 186 baker's yeast
WP_004596191  82 AGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLI 161 Rickettsia prow...
1FUO_A       162 PQLKTLTQTLNEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHVAELALGGTAVGTGLNTHPE 241 Escherichia coli
O25883       161 PSLENLLKTFKEKSQQFKEIVKIGRTHLQDATPLTLGQEFSGYASMLEHSKQQILESLEHLRELAIGGTAVGTGLNAHKE 240 Helicobacter py...
P07343       160 PALDQLRNTLDEKAKAYNDIVKIGRTHLQDATPLTLGQEISGWVHMLDRSKEMILEATDKMRALAIGGTAVGTGINAHPE 239 Bacillus subtil...
P05042       162 PQLKTLTQTLNEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHVAELALGGTAVGTGLNTHPE 241 Escherichia col...
P08417       187 PELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPG 266 Saccharomyces c...
WP_010883646 159 PALDHMIRVLDAKVEEFRHDVKIGRTHLMDAVPMTLGQEFSGYSSQLRHCLESIAFSLAHLYELAIGATAVGTGLNVPEG 238 Chlamydia pneum...
WP_010873427 163 PSLQALRDSLNEKAECFAGITKIGRTHLMDAVPLTLGQEFSGYVAQLDQGLTQINYCLPGLLELALGGTAVGTGLNSHPQ 242 Synechocystis s...
WP_009872244 159 PALEHLKKVIDAKALEFARDIKIGRTHLMDAVPMTLGQEFSGYSCQLHNCLERIGFSLTHLYELAIGGTAIGTGLNVPEG 238 Chlamydia trach...
P71384       162 PCVERLQKTFAAKSEAFKNVVKIGRTHLMDATPLTLGQEFSAYAAQLDFGLKALKNTLPHLSQLALGGTAVGTGLNTPKG 241 Haemophilus inf...
1YFM_A       187 PELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPG 266 baker's yeast
WP_004596191 162 PALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTAVGTGINSKIG 241 Rickettsia prow...
1FUO_A       242 YARRVADELAVITCAPFVTAPNKFEALATCDALVQAHGALKGLAASLMKIANDVRWLASGPRCGIGEISIPENEPGSSIM 321 Escherichia coli
O25883       241 LSEKVAEELSQFSGVKFVSAPNKFHALTSHDAIAYAHGAFKALAANLMKIANDIRWLASGPRCGLGELNIPENEPGSSIM 320 Helicobacter py...
P07343       240 FGELVSEEITKLTGQTFSSSPNKFHALTSHDEITYAHGALKALAADLMKIANDVRWLASGPRCGIGEIVIPENEPGSSIM 319 Bacillus subtil...
P05042       242 YARRVADELAVITCAPFVTAPNKFEALATCDALVQAHGALKGLAASLMKIANDVRWLASGPRCGIGEISIPENEPGSSIM 321 Escherichia col...
P08417       267 FDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIM 346 Saccharomyces c...
WP_010883646 239 FVEKIIHYLRKETDEPFIPASNYFSALSCHDALVDAHGSLATLACALTKIATDLSFLGSGPRCGLGELFFPENEPGSSIM 318 Chlamydia pneum...
WP_010873427 243 FAKKVAEEIAQLTGYTFISAPNKFAALAGHEAIAFASGVLKSIAASLMKIANDLRWMGSGPRCGLGELALPANEPGSSIM 322 Synechocystis s...
WP_009872244 239 FVEKVIQYLRRETGEPFVPASNYFAALSNHDALVQAHGSLTVLACALVKIATDLSFLGSGPRCGLGEIFFPENEPGSSIM 318 Chlamydia trach...
P71384       242 YDLKVVDYIAKFTALPFVTADNKFEALAAHDAIVETHGALRQLAMSLFKIANDIRLLASGPRSGIGEILIPENEPGSSIM 321 Haemophilus inf...
1YFM_A       267 FDVKIAEQISKETGLKFQTAPNRFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIM 346 baker's yeast
WP_004596191 242 FDIKFAQKVAEFTQQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIM 321 Rickettsia prow...
1FUO_A       322 PGKVNPTQCEALTMLCCQVMGNDVAINMGGASGNFELNVFRPMVIHNFLQSVRLLADGMESFNKHCAVGIEPNRERINQL 401 Escherichia coli
O25883       321 PGKVNPTQCEAMTMVAVQVMGNDTAIGIAASQGNFELNVFKPVIIYNFLQSLRLLSDSMESFNIHCASGIEPNREKIDYY 400 Helicobacter py...
P07343       320 PGKVNPTQSEALTMIAAQIMGNDATIGFAASQGNFELNVFKPVIIYNFLQSVQLLSDGMNSFHDKCAVGIEPNKETIQEN 399 Bacillus subtil...
P05042       322 PGKVNPTQCEALTMLCCQVMGNDVAINMGGASGNFELNVFRPMVIHNFLQSVRLLADGMESFNKHCAVGIEPNRERINQL 401 Escherichia col...
P08417       347 PGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHEL 426 Saccharomyces c...
WP_010883646 319 PGKVNPTQCEALQMVCAQVLGNNQTVIIGGSRGNFELNVMKPVIIYNFLQSVDLLSEGMRAFSEFFVKGLKVNKARLQDN 398 Chlamydia pneum...
WP_010873427 323 PGKVNPTQCEAMTMVCVQVMGNDATIGFAASQGNFELNVFKPVIIHNFLHSLHLLSDACASFRQHLVVGLQVNESKVKDF 402 Synechocystis s...
WP_009872244 319 PGKINPTQSEALQMVCSQVIGNNQSIIFSGTKGNFELNVMKPVIIYDFLQSVNLLAGAMRSFADYFVCGLKVNKGQLQQN 398 Chlamydia trach...
P71384       322 PGKVNPTQCEXMTMVCAQVFGNDTTIAFVGSQGHFQLNVFNPVMIANFLQSAQLLGDACVSFDEHCAVGIEPNYPRIKQQ 401 Haemophilus inf...
1YFM_A       347 PGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHEL 426 baker's yeast
WP_004596191 322 PGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTL 401 Rickettsia prow...
1FUO_A       402 LNESLMLVTALNTHIGYDKAAEIAKKAHKEGLTLKAAALALGYLSEAEFDSWVRPEQMVG 461 Escherichia coli
O25883       401 LHHSLMLVTALNPHVGYENAAKIAKNAHKKGISLKESALELKLLSAEDFDKFVVPEKMIG 460 Helicobacter pylori 26695
P07343       400 LSNSLMLVTALNPHIGYENAAKIAKLAHKEGLTLKEAALKLELLTEEQFNEMVKPEDMVK 459 Bacillus subtilis subsp. subtilis s...
P05042       402 LNESLMLVTALNTHIGYDKAAEIAKKAHKEGLTLKAAALALGYLSEAEFDSWVRPEQMVG 461 Escherichia coli K-12
P08417       427 LTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLG 486 Saccharomyces cerevisiae S288c
WP_010883646 399 INNSLMLVTALAPVLGYDKCSKAALKAFHESISLKEACLALGYLSEKEFDRLVVPENMVG 458 Chlamydia pneumoniae
WP_010873427 403 LDTSLMLVTALNPHIGYDNAALVAKTAFAQGITLKQAAVDLGLLTPAQFDAWVVPEQMIA 462 Synechocystis sp. PCC 6803
WP_009872244 399 VERSLMLVTALAPVLGYDKCSKIALKAFHENLSLKEACVSLGFLSEKEFDEHVIPGLMVG 458 Chlamydia trachomatis
P71384       402 LENSLMLVTALNTHIGYENAAKIAKTAHKNGTTLREEAINLGLVSAEDFDKWVRPEDMVG 461 Haemophilus influenzae Rd KW20
1YFM_A       427 LTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLG 486 baker's yeast
WP_004596191 402 RDKSLMLVTVLNPHIGYDNAAKIAKEAHKYGITLKEAAKKLNFLSEEEFDKIVVPEKMIS 461 Rickettsia prowazekii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap