Conserved Protein Domain Family
citramal_synth

?
TIGR00977: citramal_synth 
citramalate synthase
This model includes GSU1798 and is now known to represent citramalate synthase. Members are related to 2-isopropylmalate synthases and homocitrate synthases but phylogenetically distinct. The role is isoleucine biosynthesis, the first dedicated step. [Unknown function, General]
Statistics
?
PSSM-Id: 130050
View PSSM: TIGR00977
Aligned: 3 rows
Threshold Bit Score: 999.799
Threshold Setting Gi: 7387865
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P74269   7 SLWLYDTTLRDGAQREGISLSLTDKLTIARRLDQLGIPFIEGGWPGANPKDVQFFWQLQEEPLEQAEIVAFCSTRRPHKA 86  Synechocystis sp. PCC...
O66682   4 KVYIYDTTLRDGSQMEGVSFSLEDKIRIAEKLDDFGIHYIEGGWPYANPKDNLFFQKAKKMNFKNAKLTAFGSTRRPNKK 83  Aquifex aeolicus VF5
Q9WZ22   2 SIKVYDTTLRDGAQAFGVSFSLEDKIRIAEALDDLGVHYLEGGWPGSNPKDIAFFEAVKGMNFKNLKVAAFSSTRRPDVK 81  Thermotoga maritima MSB8
P74269  87 VETDKMLQAILSAGTRWVTIFGKSWDLHVLEGLQTSLAENLAMISDTIAYLRSQGRRVIYDAEHWFDGYRANPDYALATL 166 Synechocystis sp. PCC...
O66682  84 VSEDPQVESLIKAETPVVTIFGKSWDLHVTDALKTTLEENLNMIYETVEYLKRYVDEVIFDAEHFFDGYKSNPEYALQVL 163 Aquifex aeolicus VF5
Q9WZ22  82 IEEDANIQTLIKAETPVYTIFGKSWDLHVEKALRTTLEENLKMIYDTVSYLKRFADEVIYDAEHFFDGYKANREYALKTL 161 Thermotoga maritima MSB8
P74269 167 ATAQQAGAEWLVMCDTNGGTLPGQISEITTKVRRSLgldgqsdRQPQLGIHAHNDSGTAVANSLLAVEAGATMVQGTING 246 Synechocystis sp. PCC...
O66682 164 EAALKGGADWVVLCDTNGGTLPHEIYEITKKVKERF-------KDANVGIHAHNDSETAVANSLMAVLAGARQVHGTING 236 Aquifex aeolicus VF5
Q9WZ22 162 KVAEEAGADCLVLADTNGGTLPHEIEEIIEDVKKHV-------KAP-LGIHAHNDSDVAVANTLAAVRKGAVHVQGTING 233 Thermotoga maritima MSB8
P74269 247 YGERCGNANLCTLIPNLQLKLDYDCIEPEKLAHLTSTSRLISEIVNLAPDDHAPFVGRSAFAHKGGIHVSAVQRNPFTYE 326 Synechocystis sp. PCC...
O66682 237 IGERTGNANLCSIIPNLQLKLGFDVIPQENLKKLTELANFVAEIINMPLPRNMPYVGESAFAHKGGVHASAVLKNAKTYE 316 Aquifex aeolicus VF5
Q9WZ22 234 LGERCGNANLCSVIPNLVLKMGLEVIPKENLKKLFDVAHLVAELSGRPHIENMPYVGDYAFAHKGGVHVSAIKRDPRTYE 313 Thermotoga maritima MSB8
P74269 327 HIAPNLVGNERRIVVSEQAGLSNVLSKAELFGIALDRQNPACRTILATLKDLEQQGYQFEAAEASFELLMRQAMGDRQPL 406 Synechocystis sp. PCC...
O66682 317 HINPELVGNKRKITVSDLAGRSNLVHKLKEFGIEIDPKSPELKKLIDKIKELEKEGYHFEAAEASLELLIKRHFGLVKDY 396 Aquifex aeolicus VF5
Q9WZ22 314 HIDPELVGNRRIISISELSGKSNVLEKIKEMGFEIDESSPKVREILKKIKELEAQGYHFEGAEASFELLVRDMLGKRKKY 393 Thermotoga maritima MSB8
P74269 407 FLVQGFQVHCDLLTPAenpAYRNALATVKVTVNGQN--------ILEVAEGNGPVSALDQALRKALTRFYPQIADFHLTD 478 Synechocystis sp. PCC...
O66682 397 FDFDAYRVLIAKRRDD---SLPTSEATVRLSVEGVE--------EHTASLGNGPISALDRALRKALEEFYPNLKELQLID 465 Aquifex aeolicus VF5
Q9WZ22 394 FEFLGFTVMTIKNRDEe--SFSEATVKVRVPDEVAKrlghdepfEHTAAEGEGPVEALDRAVRKALEKFYPSLKDTKLTD 471 Thermotoga maritima MSB8
P74269 479 YKVRILDGGAGTSAKTRVLVESSNGDRRWTTVGVSGNILEASYQAVVEGIEYGLRLLTCGLTN 541 Synechocystis sp. PCC 6803 substr. Kazusa
O66682 466 YKVRIINESAGTSAKVRVLIESTDGKRKWGTVGVSENVIEASWIALRDSIVYKLMKDEEEGIL 528 Aquifex aeolicus VF5
Q9WZ22 472 YKVRILNEQAGTKATTRVLIESSDGKRRWGTVGVSPNIIEASWTALLESLEYKLHKDEEEMRN 534 Thermotoga maritima MSB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap