Conserved Protein Domain Family
leuA_bact

?
TIGR00973: leuA_bact 
2-isopropylmalate synthase, bacterial type
This is the first enzyme of leucine biosynthesis. A larger family of homologous proteins includes homocitrate synthase, distinct lineages of 2-isopropylmalate synthase, several distinct, uncharacterized, orthologous sets in the Archaea, and other related enzymes. This model describes a family of 2-isopropylmalate synthases found primarily in Bacteria. The homologous families in the Archaea may represent isozymes and/or related enzymes. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 130046
View PSSM: TIGR00973
Aligned: 6 rows
Threshold Bit Score: 839.799
Threshold Setting Gi: 1346444
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P94565         3 KINFFDTTLRDGEQSPGVNLNTQEKLAIAKQLERLGADIIEAGFPASSRGDFLAVQEIARTIKNCS---VTGLARCVKGD 79  Bacillus subtil...
P48576         7 RILIFDTTLRDGEQSPGATLTVEEKLSIARALARLGVDIIEAGFPFASPGDFEAVQKIAQTVGTENgpvICGLARATQKD 86  Synechocystis s...
Q9WZ23         3 RIKIFDTTLRDGEQSPGASMSIEEKVEMALMLEDLGVDLIEAGFPVSSPVQFEAVKRVASAVQKPI---VVGLARCVEKD 79  Thermotoga mari...
WP_001334810  29 QVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGFPVSSPGDFESVQTIARQVKNSR---VCALARCVEKD 105 Escherichia coli
O67862         4 KVYIFDTTLRDGEQAPGFSMTTEEKLQMAHQLAKLNVDIIEAGFAAASKGDFEAVNRIAKEVKGPV---ICSLARALESD 80  Aquifex aeolicu...
WP_005693326   4 RVIIFDTTLRDGEQALKASLTVKEKLQIALALERLGVDVMEVGFPVSSQGDFESVQTIARHIKNAR---VAALSRAVDKD 80  Haemophilus inf...
P94565        80 IDAAWEALK--DGAQPRIHVFIATSDIHLKHKLKMTREQVIERAVGMVKYAKERFPIVQWSAEDACRTELPFLAEIVEKV 157 Bacillus subtil...
P48576        87 IKAAAEALK--PAAKHRIHTFLATSDIHLEHKLKKTRAEVLAIVPEMVAYAKSLVNDIEFSPEDAGRSDPEFLYQVLEAA 164 Synechocystis s...
Q9WZ23        80 IDAAYEALKdrPKDKRMIHVFIATSPIHRKYKLRMEKEEILERIRRYVGYAKQFFDLVEFSAEDASRTEVPFLIEAYKTA 159 Thermotoga mari...
WP_001334810 106 IDVAAESLK--VAEAFRIHTFIATSPMHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAA 183 Escherichia coli
O67862        81 IEIAAKALE--PAERKRIHTFIATSPIHMEYKLRMTPDQVLERIKKAVSFARNFTDDVEFSCEDATRSEREFLYRAIETA 158 Aquifex aeolicu...
WP_005693326  81 IDAAYEALK--VAEAFRIHTFIASSALHVEAKLKRSFDDVVGMAVAAVKRARNYTDDVEFSCEDAGRTGIDNICRIVEAA 158 Haemophilus inf...
P94565       158 IDAGASVINLPDTVGYLAPAEYGNIFKYMKENVPNIHKAKLSAHCHDDLGMAVANSLAAIENGADQIECAVNGIGERAGN 237 Bacillus subtil...
P48576       165 ISAGATTINIPDTVGYTTPAEYGALIKGIADNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGN 244 Synechocystis s...
Q9WZ23       160 IEAGATTINVPDTVGYALPDEFGELIKTLREGVPGIENVDLSVHCHNDLGLAVANSLAAVQNGATQVEVTLNGIGERAGN 239 Thermotoga mari...
WP_001334810 184 INAGATTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGARQVEGAMNGIGERAGN 263 Escherichia coli
O67862       159 IKHGATVINIPDTVGYAIPEEFGQLIEDIMNNVPNIDKVILSVHCHDDLGLATANSLTAVKHGARQVECTINGIGERAGN 238 Aquifex aeolicu...
WP_005693326 159 INAGATTVNIPDTVGFCLPNEYGNIIAQVRNCVPNIDKAVISVHCHNDLGMATANSLTAVQNGARQIECTINGIGERAGN 238 Haemophilus inf...
P94565       238 AALEEIAVALHTRKDFYQ-VETG-----------ITLNEIKRTSDLVSKLTGMAVPRNKAVVGDNAFAHESGIHQDGFLK 305 Bacillus subtil...
P48576       245 AALEELVMALHVRRSYFN-PFLGrpadstapltnIDTKHIYATSRLVSELTGMMVQPNKAIVGANAFAHESGIHQDGVLK 323 Synechocystis s...
Q9WZ23       240 CALEEFVMILKVRKDKLP-YETG-----------IKTELIYPASRLLTHITGLIPSRNKPIVGENVFLHESGIHQDGVLK 307 Thermotoga mari...
WP_001334810 264 CSLEEVIMAIKVRKDILN-VHTA-----------INHQEIWRTSQLVSQICNMPIPANKAIVGSGAFAHSSGIHQDGVLK 331 Escherichia coli
O67862       239 AALEEVVMALKVRKDFFGdLYTD-----------VNTKEIYKTSRLLCRITGNFVQPNKAIVGDNAFAHESGIHQHGVLS 307 Aquifex aeolicu...
WP_005693326 239 TSLEEVVMAMKVRQDFMG-VDTH-----------INTQEIHRVSQMVSQLCNMPIQPNKAIVGSNAFAHSSGIHQDGMLK 306 Haemophilus inf...
P94565       306 EKSTYEIISPELVGVTADALVLGKHSGRHAFKDRLTALGFQFDSEEINKFFTMFKELTEKKKEITDEDLVSLILEEKVT- 384 Bacillus subtil...
P48576       324 NKLTYEIMDAESIGLTNNQIVLGKLSGRNAFGTRLKELGFDLSDTELNNAFIRFKEVADKRKEITDWDLEAIVNDEIRQ- 402 Synechocystis s...
Q9WZ23       308 HRETYEIMKPSDIGRSSETLVLGRHSGKHALRKKLETYGIKLDEETFQKVFEKFTELADRKKEVYDDDLFSIVSEVLR-- 385 Thermotoga mari...
WP_001334810 332 NRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHRMDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQ- 410 Escherichia coli
O67862       308 HRMTYEIMNPEDVGFPMSRIVLGKHSGRHALKRRLEELGFKFTKEELDRIFEKFKELADRKKEVYDEDLEALIYQEFMKi 387 Aquifex aeolicu...
WP_005693326 307 NKNTYEILSPETIGLKKEKLNLTARSGRAAVKGHMADMGYNEQDYDLDKLYDEFLKLADKKGQVFDYDLEALAFIDMQQ- 385 Haemophilus inf...
P94565       385 DRKIgYEFLSLQVHYGTSQVPTATLSLKNQeNAQlIQEAATGAGSVEAIYNTLERCIDKDVELLDYRIQSNRKGEDAFAQ 464 Bacillus subtil...
P48576       403 PPEL-FRLERVQVSCGEPSVPTATLTIRTPaGPE-ETAVAIGTGPVDAVYKAINQIVQLPNELLEYSVTSVTEGIDALGK 480 Synechocystis s...
Q9WZ23       386 EPINgYKLVHFHVHTGNTLLPTAAVVLQVG-NEK-REAAEAGNGPVDAIFKAIDKALGIQPKLEEYIIQAVGTGKNAQGE 463 Thermotoga mari...
WP_001334810 411 EEPEhFRLDYFSVQSGSNDIATAAVKLACG-EEV-KAEAANGNGPVDAVYQAINRITEYNVELVKYSLTAKGHGKDALGQ 488 Escherichia coli
O67862       388 EDHEpVKVLHFQVQSGDNMIPTATVKLEFK-GEE-REASSTGNGPVDATIKAIQKALGIEPKLLDYSIKALTPNTDAQAE 465 Aquifex aeolicu...
WP_005693326 386 GDEDrLVLDKLSAHSTKEYPATAFVQLKLD-GEKlSTSSIGGNGPVDAVYNAILNLTGLEIKMSHYNLTAKGEGAEALGQ 464 Haemophilus inf...
P94565       465 VYVRVLVNGKESAGRGIAQDVLEASAKAYLNAVN 498 Bacillus subtilis subsp. subtilis str. 168
P48576       481 VSVRLRHNGVIYTGYAANTDIIVASARAYLGALN 514 Synechocystis sp. PCC 6803 substr. Kazusa
Q9WZ23       464 VKLTLRIDNELYSGRGVSTDIVEASAIAYINAIN 497 Thermotoga maritima MSB8
WP_001334810 489 VDIVANYNGRRFHGVGLATDIVESSAKAMVHVLN 522 Escherichia coli
O67862       466 ARVVLELDGVKASGRGVDTDIIKASVKAFTDALN 499 Aquifex aeolicus VF5
WP_005693326 465 VDIVVEHKGRKFHGVGLATDIVESSALALVHAIN 498 Haemophilus influenzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap