Conserved Protein Domain Family
3a0106s03

?
TIGR00971: 3a0106s03 
sulfate/thiosulfate-binding protein
This model describes binding proteins functionally associated with the sulfate ABC transporter. In the model bacterium E. coli, two different members work with the same transporter; mutation analysis says each enables the uptake of both sulfate and thiosulfate. In many species, a single binding protein is found, and may be referred to in general terms as a sulfate ABC transporter sulfate-binding protein. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 130044
View PSSM: TIGR00971
Aligned: 5 rows
Threshold Bit Score: 573.836
Threshold Setting Gi: 446212429
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P16700        13 LVASLLL---AghvQATELLNSSYDVSRELFAALNPPFEQQWAKDNGgDKLTIKQSHAGSSKQALAILQGLKADVVTYNQ 89  Escherichia col...
AAD16180      12 LASTSVL---A---KDIQLLNVSYDPTRELYEQYNKAFAAHWKQETG-DNVVVRQSHGGSGKQATSVINGIEADVVTLAL 84  Enterobacter cl...
P06997        12 LAATSVM---A---KDIQLLNVSYDPTRELYEQYNKAFSAHWKQQTG-DNVVIRQSHGGSGKQATSVINGIEADVVTLAL 84  Escherichia coli
WP_000507068   7 LASTSIL---A---KDIQLLNVSYDPTRELYEQYNKAFSAHWKQETG-DNVVIRQSHGGSGKQATSVINGIEADVVTLAL 79  Salmonella ente...
WP_000290284  13 LAAMLLLvgqA---QATELLNSSYDVSRELFAALNPPFEQQWAKENGgDKLTIKQSHAGSSKQALAILQGLKADVVTYNQ 89  Salmonella ente...
P16700        90 VTDVQILHDKGKlIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYLAAWGAA 169 Escherichia col...
AAD16180      85 AYDVDAIAERGR-IDKNWIKRLPDNSAPYTSTIVFLVRKGNPKQIKDWNDLIKPGVSVITPNPKSSGGARWNYLGAWGYA 163 Enterobacter cl...
P06997        85 AYDVDAIAERGR-IDKEWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVSVITPNPKSSGGARWNYLAAWGYA 163 Escherichia coli
WP_000507068  80 AYDVDAIAERGR-IDKNWIKRLPDNSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVSVITPNPKSSGGARWNYLAAWGYA 158 Salmonella ente...
WP_000290284  90 VTDVQILHDKGKlIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYLAAWGAA 169 Salmonella ente...
P16700       170 DKADGGDKGKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVA 249 Escherichia col...
AAD16180     164 LHHNNGDQAKAQEFVKALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLATHELGKDKFEIVTPSESILAEPTVS 243 Enterobacter cl...
P06997       164 LHHNNNDQAKAQDFVRALYKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLAANELGKDKFEIVTPSESILAEPTVS 243 Escherichia coli
WP_000507068 159 LHHNNNDQAKAQDFVKALFKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLATNELGKDKFEIVTPSESILAEPTVS 238 Salmonella ente...
WP_000290284 170 DNADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVA 249 Salmonella ente...
P16700       250 WVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDYYYRVNNPEVMDKLKDKFPQTELFRVEDKFGSWPEVMKTHFTSGGEL 329 Escherichia col...
AAD16180     244 VVDKVVEKKDTKAVAEAYLKYLYSPEGQEIAAKNFYRPRDAAVAKKYEGEFPKLKLFTIDDVFGGWTKAQKEHFSNGGTF 323 Enterobacter cl...
P06997       244 VVDKVVEKKGTKEVAEAYLKYLYSPEGQEIAAKNYYRPRDAEVAKKYENAFPKLKLFTIDEEFGGWTKAQKEHFANGGTF 323 Escherichia coli
WP_000507068 239 VVDKVVEKKDTKAVAEAYLKYLYSPEGQEIAAKNFYRPRDADVAKKYDDAFPKLKLFTIDEVFGGWAKAQKDHFANGGTF 318 Salmonella ente...
WP_000290284 250 WVDKNVQANGTEKAAKAYLNWLYSPQAQTIITHYYYRVNNPEIMGKQADKFPQTELFRVEDKFGSWPEVMKTHFASGGEL 329 Salmonella ente...
P16700       330 DKL 332 Escherichia coli K-12
AAD16180     324 DQI 326 Enterobacter cloacae
P06997       324 DQI 326 Escherichia coli
WP_000507068 319 DQI 321 Salmonella enterica
WP_000290284 330 DKL 332 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap