Conserved Protein Domain Family
3a0106s01

?
TIGR00968: 3a0106s01 
sulfate ABC transporter, ATP-binding protein
[Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 130041
View PSSM: TIGR00968
Aligned: 5 rows
Threshold Bit Score: 440.39
Threshold Setting Gi: 3023607
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P16676         3 IEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARDRKVGFVFQH 82  Escherichia col...
P74548         3 IIINNVSKQFGDFTALKDINLEVPDGKLVALLGPSGSGKSTLLRAIAGLEEPDQGQIIINGQDATHVDIRKRNIGFVFQH 82  Synechocystis s...
P56344         3 ILIENISKRFGSFQALDRVNLEIKNGSLVGLLGPSGSGKSTLLRVLAGLEKPDSGRIWLEGQDATQMKLQDREIGFVFQN 82  Chlorella vulgaris
WP_011378138   3 IQVSQVSKQFGSFQAVKDVDLTVETGSLVALLGPSGSGKSTLLRLIAGLEQPDSGRIFLTGRDATNESVRDRQIGFVFQH 82  Synechococcus e...
WP_031652345   5 IVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGTITINGRDVTRVPPQRRGIGFVFQH 84  Mycobacterium t...
P16676        83 YALFRHMTVFDNIAFGLTVLprreRPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDE 162 Escherichia col...
P74548        83 YALFKHLTIRQNIAFGLEIR----KHPPAKTKERVEELLSLIQLEGLGNRYPSQLSGGQRQRVALARALAVQPQVLLLDE 158 Synechocystis s...
P56344        83 YALFPHLTVSENVAFGLEIQ----KIDSLLKKKRVNELLKLMQLEKFGDSYPNQLSGGQRQRVALARALAMEPKVLLLDE 158 Chlorella vulgaris
WP_011378138  83 YALFKHLTVRKNIAFGLELR----KHTKEKVRARVEELLELVQLTGLGDRYPSQLSGGQRQRVALARALAVQPQVLLLDE 158 Synechococcus e...
WP_031652345  85 YAAFKHLTVRDNVAFGLKIR----KRPKAEIKAKVDNLLQVVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDE 160 Mycobacterium t...
P16676       163 PFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVLEFMGEVNR 242 Escherichia col...
P74548       159 PFGALDAKVRKELRAWLRKLHDEVHLTSVFVTHDQEEAMEVADEIVVMSNGKIEQVGTAEEIYEHPASPFVMGFIGEVNV 238 Synechocystis s...
P56344       159 PFAALDAKIRKQLRSWLRELHHKISVTTVFVTHDYSEAMELAQEIVLLENGKIIQIGSAQELSDHPTNTFVTNFLGLK-- 236 Chlorella vulgaris
WP_011378138 159 PFGALDAKVRKDLRSWLRKLHDEVHVTTVFVTHDQEEAMEVADQIVVMNHGKVEQIGSPAEIYDNPATPFVMSFIGPVNV 238 Synechococcus e...
WP_031652345 161 PFGALDAKVREELRAWLRRLHDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST 240 Mycobacterium t...
P16676       243 L 243 Escherichia coli K-12
P74548       239 L 239 Synechocystis sp. PCC 6803 substr. Kazusa
P56344           -     Chlorella vulgaris
WP_011378138 239 L 239 Synechococcus elongatus
WP_031652345 241 L 241 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap