3BXY


Conserved Protein Domain Family
dapD

?
TIGR00965: dapD 
Click on image for an interactive view with Cn3D
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
This enzyme is part of the diaminopimelate pathway of lysine biosynthesis. Alternate name: tetrahydrodipicolinate N-succinyltransferase. The closely related TabB protein of Pseudomonas syringae (pv. tabaci), SP|P31852|TABB_PSESZ, appears to act in the biosynthesis of tabtoxin rather than lysine. The trusted cutoff is set high enough to exclude this gene. Sequences below trusted also include a version of this enzyme which apparently utilize acetate rather than succinate (EC: 2.3.1.89). [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130038
View PSSM: TIGR00965
Aligned: 4 rows
Threshold Bit Score: 485.171
Threshold Setting Gi: 6647496
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BXY_A        14 QLQNIIETAFERRAEITP-ANADTVTREAVNQVIALLDSGALRVAEKI-DGQWVTHQWLKKAVLLSFRINDNQVIEGAES 91  Escherichia col...
P03948         3 QLQNIIETAFERRAEITP-ANADTVTREAVNQVIALLDSGALRVAEKI-DGQWVTHQWLKKAVLLSFRINDNQVIEGAES 80  Escherichia coli
WP_002224875   2 SLQNIIETAFENRADITP-TTVTPEVKEAVLETIRQLDSGKLRVAERLgVGEWKVNEWAKKAVLLSFRIQDNEVLNDGVN 80  Neisseria
Q9ZDX0         3 YIIKEIEEAWQIKENILHdSSKLIKLKKILNESIASLNQGIIRVCEKQ-GNQWKVNEWVKKAILLYFITTESQLYNNNYN 81  Rickettsia prow...
3BXY_A        92 RYFDKVPMKF-ADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS 170 Escherichia col...
P03948        81 RYFDKVPMKF-ADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS 159 Escherichia coli
WP_002224875  81 KYFDKVPTKF-ADWSEDEFKNAGFRAVPGAVARRGSFVAKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLS 159 Neisseria
Q9ZDX0        82 SWYDKVAPKFpADTDKNIFKEAAIRKVPGAIVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHIS 161 Rickettsia prow...
3BXY_A       171 GGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVVSGNLP 250 Escherichia col...
P03948       160 GGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLP 239 Escherichia coli
WP_002224875 160 GGVGIGGVLEPLQAAPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239 Neisseria
Q9ZDX0       162 GGAGIGGVLEPLQAKPVIIEDNCFVGARSEIAEGVIVEEGSVISMGVFIGSSTKIVYRDTGEIIYGRIPAYSVVVPGILP 241 Rickettsia prow...
3BXY_A       251 S-KDGKYSLYCAVIVKKVDAKTRGKVGINELLR 282 Escherichia coli O157:H7
P03948       240 S-KDGKYSLYCAVIVKKVDAKTRGKVGINELLR 271 Escherichia coli
WP_002224875 240 S-KDGSHSLYCAVIVKRVDAQTRAKTSVNELLR 271 Neisseria
Q9ZDX0       242 PpEVGKPGLYCVVIVKQVDKTTRGKVSINDLLR 274 Rickettsia prowazekii str. Madrid E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap