2QOU


Conserved Protein Domain Family
S15_bact

?
TIGR00952: S15_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S15, bacterial/organelle
This model is built to recognize specifically bacterial, chloroplast, and mitochondrial ribosomal protein S15. The homologous proteins of Archaea and Eukarya are designated S13. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130027
View PSSM: TIGR00952
Aligned: 13 rows
Threshold Bit Score: 93.9277
Threshold Setting Gi: 6094157
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QOU_O         4 STEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIE 83  Escherichia coli
Q9ZD44         4 TTERKQQLIKEYAITENDTGSTAVQCAILTERINNLTEHFKSNHKDHTSRRGLLILVGRRRRLLNYIKKNNVSEYLDLIS 83  Rickettsia prow...
O33327         4 TAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSRRGLLLLVGRRRRLIKYISQIDVERYRSLIE 83  Mycobacterium t...
O83857         4 TKERTASVVQQYGSGEKDTGSSSVQIALLTERIRQLTDHCKVHPKDKSSNRGLLVLVGRRRRLLRYSRRVSMGAYRSLVK 83  Treponema palli...
O51744         3 DKKQKQKIVSEFGKNESDTGSVGVQIALITGRIKYLTEHLKINKKDHSSKRGLLKLVGQRRSLLRYYQKKDLEAYRMLIS 82  Borrelia burgdo...
Q9Z6Q9         4 DKGTKEEITKKFQLHEKDTGSADVQIAILTEHIAELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYLNSTDTERYKNLIT 83  Chlamydia pneum...
O66594         4 PKDVKWDLIRQFQRHEQDTGSPEVQIAILTERINRLTEHMKKHKKDIHSRRGLIAMVNKRRKLLEYLRETDYAKYLEVVQ 83  Aquifex aeolicu...
P72866         4 TQIRKQELMTEYQAHETDTGSADLQVAFLTERITQLTGHLKANPKDHASRRGLLKMIGRRKRLLSFINAREPERYQALIK 83  Synechocystis s...
P47663         1 MKIDKEQIIKAHQLHKNDVGSVQVQISILTDQIKKLTDHLLANKKDFISKRGLYTKVSKRKRLLKYLKERNIETYRDLIK 80  Mycoplasma geni...
P75173         1 MQIDKNGIIKSAQLHDKDVGSIQVQVSLLTSQIKQLTDHLLANKKDFISKRGLYAKVSKRKRLLKYLKHNDLEAYRNLVK 80  Mycoplasma pneu...
WP_005692929 114 STEKKAAIVAEFGRDAKDTGSSEVQIALLTAQINHLQTHFAEHKKDHHGRRGLLRMVSRRRKLLDYLKRTDLALYQSTIA 193 Haemophilus inf...
P56022         4 NLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLKANPKDHSSRLGLLKLVAQRRNLLKYIKRTNHARYVVLIE 83  Helicobacter py...
WP_003220957   4 TQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYLRNKDVTRYRELIN 83  Bacillales
2QOU_O        84 RLGLRR 89  Escherichia coli
Q9ZD44        84 KLGIRK 89  Rickettsia prowazekii str. Madrid E
O33327        84 RLGLRR 89  Mycobacterium tuberculosis
O83857        84 SLGLRK 89  Treponema pallidum subsp. pallidum str. Nichols
O51744        83 KLGLRK 88  Borrelia burgdorferi B31
Q9Z6Q9        84 RLNLRK 89  Chlamydia pneumoniae
O66594        84 KLNLKV 89  Aquifex aeolicus VF5
P72866        84 RLGIRR 89  Synechocystis sp. PCC 6803 substr. Kazusa
P47663        81 NLNLRG 86  Mycoplasma genitalium G37
P75173        81 TLNLRG 86  Mycoplasma pneumoniae M129
WP_005692929 194 RLGLRR 199 Haemophilus influenzae
P56022        84 KLGIKD 89  Helicobacter pylori 26695
WP_003220957  84 KLGLRR 89  Bacillales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap