Conserved Protein Domain Family
2a75

?
TIGR00948: 2a75 
L-lysine exporter
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130023
View PSSM: TIGR00948
Aligned: 8 rows
Threshold Bit Score: 209.913
Threshold Setting Gi: 499584926
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q11154         4 LKVAIGPQNAFVLRQGIRREY---VLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNA 80  Mycobacterium t...
Q10871        15 LIAAIGAQNAFVLRQGIQREH---VLPVVALCTVSDIVLIAAGIAGFGALIGAHPRALNVVKFGGAAFLIGYGLLAARRA 91  Mycobacterium t...
AAB70019       1 MIIPIGAQNAFVLSRGIHRNH---HLLAATLCCLCDLILIGIGVFGGANLLAASPIGLALLTWGGVLFLCWFGIRSLRSA 77  Aeromonas salmo...
CAA61655       1 MIIPIGAQNAFVLSRGIHRNH---HLLTATLCCLCDLVLIGIGVFGGANLLAASPIGLALLTWGGVLFLGWFGIRSLRSA 77  Aeromonas hydro...
P11667        15 MILPLGPQNAFVMNQGIRRQY---HIMIALLCAISDLVLICAGIFGGSALLMQSPWLLALVTWGGVAFLLWYGFGAFKTA 91  Escherichia col...
WP_011265709  14 lllsIGPQNVLVIKQGIKREG---LIAVLLVCLISDVFLFIAGTLGVDLLSNAAPIVLDIMRWGGIAYLLWFAVMAAKDA 90  Corynebacterium...
WP_014906281  83 LILPLGVQNVFIFQQGALQKHiwrALPAVISASVCDTLLIVLAVAGVSVIVQELPVFETVMMAGGFLFLLYMGWVTWNIR 162 Bacillus subtilis
WP_000498401  15 LCAAVGAQSLFIVERGMARNY---VFLICALCFMCDIVLMSMGVFGVGAYFAKNLYLSLSLNLFGALFTGFYAFLALKTL 91  Helicobacter py...
Q11154        81 WR-----------PSGLVPSES----------------------GPAALIGVVQMCLVVTFLNPHVYLDTVVLIGALANE 127 Mycobacterium t...
Q10871        92 WR-----------PVALIPSGA----------------------TPVRLAEVLVTCAAFTFLNPHVYLDTVVLLGALANE 138 Mycobacterium t...
AAB70019      78 WQg----------QGAALADSP----------------------RLMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQ 125 Aeromonas salmo...
CAA61655      78 WRg----------QGAKLADSP----------------------QLMGVKSVLAMTLGVTLLNPHVYLDTLMLLGSFGSQ 125 Aeromonas hydro...
P11667        92 MSs----------NIELASAEV----------------------MKQGRWKIIATMLAVTWLNPHVYLDTFVVLGSLGGQ 139 Escherichia col...
WP_011265709  91 MTnkveapqiieeTEPTVPDDTplggsavatdtrnrvrvevsvdKQRVWVKPMLMAIVLTWLNPNAYLDAFVFIGGVGAQ 170 Corynebacterium...
WP_014906281 163 PN--------------TSQNEK----------------------HTFTPKKQAAFAAAVSLLNPHAILDTIGVIGTSSLQ 206 Bacillus subtilis
WP_000498401  92 FQt----------FKKKQVQTP----------------------KKLSLKKTLLFTLGVTLLNPQVYLEMVFLIGASALS 139 Helicobacter py...
Q11154       128 ESDL-RWFFGAGAWAASVVWFAVLGFSAGRL-QPFFATPAAWRILDALVAVTM 178 Mycobacterium tuberculosis
Q10871       139 HSDQ-RWLFGLGAVTASAVWFATLGFGAGRL-RGLFTNPGSWRILDGLIAVMM 189 Mycobacterium tuberculosis
AAB70019     126 FAEPlRPAFAAGAMLASLVWFYSLAFGAAAL-SPWLARGRVQQAIDTIVGLIM 177 Aeromonas salmonicida
CAA61655     126 FAEElRSAFAAVAMLASLVWFYSLAFGAVVL-SPWLARSRQGYSKLLILLLVS 177 Aeromonas hydrophila
P11667       140 LDVEpKRWFALGTISASFLWFFGLALLAAWL-APRLRTAKAQRIINLVVGCVM 191 Escherichia coli K-12
WP_011265709 171 YGDTgRWIFAAGAFAASLIWFPLVGFGAAAL-SRPLSSPKVWRWINVVVAVVM 222 Corynebacterium glutamicum
WP_014906281 207 YSGLeKWLFMAACIAVSWIWFISLAIAGRLF-QTIDTSGRLMLIVNKCSAAVM 258 Bacillus subtilis
WP_000498401 140 FNLAqKFVFLAGTLSAALSWLLLLCTLSLRYgSKLLNNQKIFMGVNLFVTAIM 192 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap