Conserved Protein Domain Family
2a6301s04

?
TIGR00944: 2a6301s04 
Multicomponent K+:H+antiporter
[Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130019
View PSSM: TIGR00944
Aligned: 3 rows
Threshold Bit Score: 514.335
Threshold Setting Gi: 1072398
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA35098   5 NMLVLTLVIPVITAILLVFIGKR-PIIKRYVALGGTLLTLVAAIINLANVVK-----HGPIRVELGSWKAPYSIVFVLDI 78  Staphylococcus aureus
CAB07908   3 NFVILAILIPILSAILLIFMTKN-LMLMRIFSTAASAIGIVISGILVQTVFT-----KGIQTLSLGGWKAPYGIVLAADQ 76  Bacillus subtilis s...
CAA63737  15 HLLILPILLPLAVAAVLIPINERdRTLKGAIGFASTLVVFILSMILMRLAAAgtgslPGSGVYQLGNWPAPFGIVLVLDR 94  Sinorhizobium meliloti
BAA35098  79 FSALLIITSIIITAIVILYSYQTIGIERERYYYYFSVLFMLIGIIGAFTTGDIFNLFVFFEVFLMSSYFLLVIGSTKIQL 158 Staphylococcus aureus
CAB07908  77 FASLLVLTTAIIGLLVGLYSFRSVGEKRERSFYYSGVQFLLAGVSGAFLTGDLFNMYVFFELLLIASYMLIVLGGTKIQL 156 Bacillus subtilis s...
CAA63737  95 LSALMLCLTSGLALAAQAYSMARWHTAG--HHFHSLFQLLVAGLNGAFLTGDLFNLFVFFEMMLAASYGLLLHGSGPLRV 172 Sinorhizobium meliloti
BAA35098 159 QETIKYVLVNVVSSSFFVMGVAILYSVVGTLNLADISNKLAnlSAHDSGLVNIVFILFIFVFATKAGVFPMFVWLPSAYY 238 Staphylococcus aureus
CAB07908 157 RESLKYIVFNIVSSALFVIGVGFLYAVTGTLNMADLSVKIS--ESGQTGLITVIGVLLLLVFGMKGGIFPLYFWLPGSYY 234 Bacillus subtilis s...
CAA63737 173 KAGLHYIAVNLAASALFLIGVSLIYGAAGTLNMADLATKLAalEPRSRTLVEMGSAILGVAFLVKAGMWPLSFWLPTAYA 252 Sinorhizobium meliloti
BAA35098 239 APPIPIIAFFGALLTKVGVYAIARTLSLFFSDNV----SFSHYVILFLALLTIIFGCVGAVAYANIKKIILYNVMIAVGV 314 Staphylococcus aureus
CAB07908 235 APPAAISALFGALLTKVGLYAITRVFTLIFIHDT----AFTHQLMIWLAALTVIFGVIGSLAYSNVMKIVIYNIITAVGV 310 Bacillus subtilis s...
CAA63737 253 AATPPVAGVF-AVLTKVGIYVIIRLHLLVFGTAAgassGFGQEWLVTGGMLTIAFGGIGVLASQAMGRLAGYSVLVSSGT 331 Sinorhizobium meliloti
BAA35098 315 ILVGVAMMTESGMIGAIYYTLHDMLVKLALFLLIGIMIKITGT------ADLRQFGGLIKR-------------YPVLGW 375 Staphylococcus aureus
CAB07908 311 ILFGVAVHTPASIQGAIYYLIHDMLIKGALFMLAGTLIALTGT------ASLHKMGGLIKR-------------YPVLGW 371 Bacillus subtilis s...
CAA63737 332 LLAAVGLGHDGMLAGALFYLVSSTLTIGAFFLLIELVERGRDAgadvlaVTMEAYGDFDEDeeeeevgaaipgtMAVLGL 411 Sinorhizobium meliloti
BAA35098 376 SFFIAALSLAGIPPLSGFYGKFFIVQSTFER-----------GFYLSGVIVLLSSLVVLYSVIRIFLQGFFGQPK-GYDL 443 Staphylococcus aureus
CAB07908 372 MFFISAISLAGIPPLSGFVGKFKIAEGGFAE-----------GEFTISMLILLSSLLVLYSVLRIFIHAFWGEEK-ETPK 439 Bacillus subtilis s...
CAA63737 412 CFCLCALLLAGLPPLSGFIAKFALISGLFDMpaaelatamsaADWTYVTLLILSGLAAMIAMNRIGIRTFWASIEgTIPR 491 Sinorhizobium meliloti
BAA35098 444 NNKVDVKYLTTIAIVAVVITVLYG 467 Staphylococcus aureus
CAB07908 440 PNHRTAKGLLYPAAIFLLLSLLFG 463 Bacillus subtilis subsp. subtilis str. 168
CAA63737 492 VVVIEITPVVVLLGACIFLSLQAG 515 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap